KEGG   Desulfotomaculum reducens: Dred_3183
Entry
Dred_3183         CDS       T00494                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dred_3183
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:drm01007]
    Dred_3183
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:drm03016]
    Dred_3183
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_3183
Enzymes [BR:drm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Dred_3183
Amino acid related enzymes [BR:drm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Dred_3183
Transfer RNA biogenesis [BR:drm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dred_3183
 Prokaryotic type
   Other AARSs
    Dred_3183
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_3183
SSDB
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1g tRNA-synt_1f tRNA-synt_1e
Other DBs
NCBI-ProteinID: ABO51685
UniProt: A4J9D2
LinkDB
Position
complement(3462234..3463919)
AA seq 561 aa
MQGLVENIKSSLAKALQVAIAGAVDKGQVNKLEIPEVIIEVPREKGHGDFATNLAMQLAK
PAKMAPRKIAEAIIENLDLANTQVERVEIAGPGFINFYLQPSWVHGVIPMIIQEDRNYGR
LELGDGQRVQVEFVSANPTGLLHMGNARGAALGDSLASILDFAGYRVSREYYINDAGNQI
ENFGKSLEVRYLQQLGQDIQLPEEGYHGEDIIDTVKGYINKNGRGLLDADQTTRRKTLAA
YALQEKLTHIRNTLLDFGVVYDVWYSEQALHDSGAIQETLDELRQKGFIYEQENALWFKA
TAFGDEKDEVVVRSNGIPTYFAADIAYHKDKYKRGFDRVIDIWGADHHGHVNRMKGSMEA
LGHNRDNLQIILMQLVRLLRGGEVVRMSKRTGQFVTLEELVEEVGRDAARYFFVMRSPDS
HLEFDLDLAKSQTNDNPVFYIQYAHARICSILRQLQEQGRPLPEIAAINPTVLKEEAELE
LLRKLADFPSEIAAAAEMMAPHRIARYLHDLAGLFHSFYNSHRVITENEAISEARLVLVQ
CVRIVLRNALGLLGLTAPEKM
NT seq 1686 nt   +upstreamnt  +downstreamnt
ttgcaaggattggtagaaaatataaaatccagcttagccaaagctttgcaggttgcaatt
gctggggctgtggacaagggtcaggtaaacaagctggaaatacctgaagttatcattgaa
gtaccgcgggaaaaaggacatggagactttgccactaatttagccatgcaactggccaag
cctgctaaaatggcccccagaaaaatagcagaggcaattatagaaaacctggacctggca
aatacacaagtggaacgtgtggaaatagccggcccgggctttattaatttctacctgcaa
cctagctgggtacacggagttattcctatgattattcaagaggatcgaaactatgggcgg
ctggaactgggagatggtcaaagggtacaagtagaatttgttagtgcaaaccccactggt
ctgctacacatgggaaatgcccggggagcagctttgggagatagtttggcgtcgatctta
gattttgccggctatcgggttagtagggaatactatattaatgatgccgggaaccagatc
gaaaactttggcaagtccctagaggtgcgttatctacaacaattgggtcaggatatccaa
ttgcccgaagaaggatatcatggagaagatattattgacacagtaaagggttatattaac
aaaaatggtaggggattgctggatgcagaccagacgactcgtcggaagaccctggctgcc
tatgcattgcaagagaaattaacccatattcgtaatacactgttggactttggtgttgta
tatgatgtatggtactctgaacaagcccttcatgatagcggtgccattcaagaaacactg
gatgaattgcgccaaaagggttttatttacgaacaagaaaatgctctctggttcaaagcc
actgcctttggtgatgaaaaagatgaagttgttgttcgctctaatggcatacccacctat
tttgctgcggatattgcctatcacaaggacaaatataagcggggctttgaccgtgtaatt
gatatttggggtgccgatcaccatggccatgtgaaccggatgaagggttctatggaagcc
ctaggccataaccgcgacaacctgcaaattatccttatgcagttagtccgtttattacgt
gggggcgaagttgttcgtatgtcaaaacgtaccggacagtttgttacactggaagaattg
gtggaagaggttggaagggacgcagcgcgttatttctttgttatgagaagtccagatagc
catttggagtttgatctggatttagcaaagtcccaaaccaatgataacccggttttttat
attcagtatgctcatgcccggatttgtagtattttacgtcaactgcaagagcaaggacgt
ccattgcctgaaatagcagctataaatcctacagtactaaaagaagaggcagaattagag
ttgttgcgcaaactggcagatttccccagcgaaattgctgcagcagcggaaatgatggca
cctcatcggatagcccggtatttgcacgacctggcaggcttatttcatagcttctacaac
agtcatcgagtgattacagaaaacgaagcgatatcagaagctcgtttggttttggtacaa
tgtgtacgcattgtattaagaaacgctctggggctgttgggcttaacggcaccagaaaaa
atgtag

DBGET integrated database retrieval system