KEGG   Desulfotomaculum reducens: Dred_3308
Entry
Dred_3308         CDS       T00494                                 

Definition
(GenBank) SSU ribosomal protein S6P
  KO
K02990  small subunit ribosomal protein S6
Organism
drm  Desulfotomaculum reducens
Pathway
drm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dred_3308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:drm03011]
    Dred_3308
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_3308
Ribosome [BR:drm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dred_3308
  Bacteria
    Dred_3308
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_3308
SSDB
Motif
Pfam: Ribosomal_S6 bact-PGI_C T3RM_EcoP15I_C BspA_v
Other DBs
NCBI-ProteinID: ABO51808
UniProt: A4J9Q5
LinkDB
Position
complement(3589663..3589950)
AA seq 95 aa
MRNYEVMYIIKPEVEEEKVTALMEKFKSVVEEKGAEVTKLDKWGKRRLAYEINKIKEGIY
VLMQFKAEPAASAELDRVMKINDDIVRHMIIREGE
NT seq 288 nt   +upstreamnt  +downstreamnt
gtgcgcaactacgaagtaatgtacatcatcaaacccgaagttgaagaggaaaaagtaact
gcattgatggaaaaatttaagtctgttgtagaagaaaagggcgccgaagttaccaaacta
gacaagtggggtaagcgtcgtctggcctatgagatcaacaagatcaaagaaggtatctac
gtattaatgcagttcaaagcagaacctgcggcttctgctgaacttgacagggttatgaaa
attaatgatgatatagttcgtcacatgatcattcgcgaaggcgaatag

DBGET integrated database retrieval system