KEGG   Desmodus rotundus (common vampire bat): 112296254
Entry
112296254         CDS       T05907                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04072  Phospholipase D signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04540  Gap junction
dro04630  JAK-STAT signaling pathway
dro04810  Regulation of actin cytoskeleton
dro05160  Hepatitis C
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05226  Gastric cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112296254 (EGF)
   04012 ErbB signaling pathway
    112296254 (EGF)
   04014 Ras signaling pathway
    112296254 (EGF)
   04015 Rap1 signaling pathway
    112296254 (EGF)
   04630 JAK-STAT signaling pathway
    112296254 (EGF)
   04066 HIF-1 signaling pathway
    112296254 (EGF)
   04068 FoxO signaling pathway
    112296254 (EGF)
   04020 Calcium signaling pathway
    112296254 (EGF)
   04072 Phospholipase D signaling pathway
    112296254 (EGF)
   04151 PI3K-Akt signaling pathway
    112296254 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112296254 (EGF)
   04540 Gap junction
    112296254 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112296254 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296254 (EGF)
   05231 Choline metabolism in cancer
    112296254 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112296254 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112296254 (EGF)
   05212 Pancreatic cancer
    112296254 (EGF)
   05226 Gastric cancer
    112296254 (EGF)
   05214 Glioma
    112296254 (EGF)
   05218 Melanoma
    112296254 (EGF)
   05219 Bladder cancer
    112296254 (EGF)
   05215 Prostate cancer
    112296254 (EGF)
   05213 Endometrial cancer
    112296254 (EGF)
   05224 Breast cancer
    112296254 (EGF)
   05223 Non-small cell lung cancer
    112296254 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112296254 (EGF)
   05165 Human papillomavirus infection
    112296254 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112296254 (EGF)
Cytokines and growth factors [BR:dro04052]
 Growth factors
  Growth factors (RTK binding)
   112296254 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF DUF5050 EGF_3 DUF3357
Other DBs
NCBI-GeneID: 112296254
NCBI-ProteinID: XP_024406859
LinkDB
Position
Unknown
AA seq 1094 aa
MLFYLVILLPVVFKFSFVSLSALQPWNCPSGNGDSACAGPAPFLIFSHGNSIFRIDLEGT
NHEKLVTDAGVSVIMDFHYSKERIYWVDLEKQLLQRVFLNGTRQEKVCNIEKNVSGMAIN
WINEELIWSNQQEGIITVTDMKGNNSHVLLSTLKYPANVAVDPVERFVFWSSEVAGSLHR
ADLNGAEVKILLETSEKITAMSLDVLDKRLFWIQYNREGSISRICSCDYNGGSVHFSKHL
TQHNLFAMSLFGDRIFYSTWRKKTIWIANKHTGKDMVRINLNSSFAPPGGIKVVHPFVQP
KAEHDAWADQKLCTLRRGNCRGSVCGRDPKSHLCTCAEGYALSKDGKYCEDVNECAFWNH
GCTLGCENIAGSYYCTCPLGFVLLPDGKRCHQLISCPNNASECSHGCVLTSDGPLCFCPE
GSVLETDGKTCSGCSSPDNGGCSQLCLALSPVSWECGCLPGYDLQLDRKSCAASGPQPLL
LFANSQDIRHMHFDGTDYVTLLSQQMGAVFALDHDPVENKVYFAHTALKWIERANMDGSQ
RERLIEEAVEVPEGLAVDWIARKLYWTDGGKSVIEGSDLNGKHREVIIKEDISQPRGIAV
HPMAKRLFWTDMGINPRIESSSLRGIGRLVIASSGLVWPSGITIDFLTDKLYWCDAKQSV
IEMANLDGSKRQRLVQNDVGRPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVRLRGSM
LKPSSLVVVHPLAKPGADPCLYQNGGCAHICKEEFGTAQCSCREGFVKASDGKMCLALNV
HQISTGSEVDLSNQEMSSDLLSGSQGSEDNTTQSQHMLVAEIMVSDEDDCGPMGCGAHSQ
CVPEGEVATCQCLRGFAGDGRVCSDVDECDMGTAACPHPSSECINTEGGYVCRCSEGYQG
DGTHCLDIDECQLGMHTCGENTTCTNMEGNYTCMCASSLSEPGRNCPDSTPPSHLREDGR
YSVRNTYRECPPSHAGYCLHGGVCMYIESVDTYACNCVVGFVGERCQYRDLRWWELRHAD
QGRRQRNITVVAVCVVALVLLLLLVLWGARHYRTQKLLSKNPENPYEDSNREVSVSRPAD
REAGTASCPQPWVM
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgctgttctaccttgtcattctgttgccggtagtttttaaattcagttttgttagtctc
tcagcactccagccctggaactgtccctcgggaaatggggattctgcttgtgcgggtcct
gcacccttcttaattttttctcatggaaatagtatctttagaattgacctggaaggaacc
aatcatgagaaattggtgacagatgctggcgtgtcagtgatcatggattttcattacagc
aaagaaagaatctattgggtagatctagaaaaacaacttttgcaaagagttttcctcaac
gggacgaggcaagagaaagtatgcaatatagagaaaaatgtttcaggaatggcaataaat
tggataaatgaagaacttatttggtcaaatcaacaggaaggaatcattacagtaacagat
atgaaaggaaacaattcccatgttcttttaagcaccttaaagtatcctgcaaatgtagca
gttgatccagtagaaaggtttgtattttggtcttcagaggtggccggcagccttcacaga
gcagacctcaatggtgctgaggtgaagatcctgttagagacgtcagagaaaataacagcc
atgtcgctggatgtgctcgataaacggctcttttggattcagtacaacagagaaggaagc
atttctcgtatttgttcctgtgattataatggaggttctgtccatttcagcaaacatctt
acacagcacaatttgtttgcaatgtccctttttggtgatcgtatcttctattcaacatgg
agaaagaagacaatttggatagctaacaaacacacagggaaggatatggttagaattaac
ctcaactcatcatttgcaccacctggtggcattaaagtagtgcacccattcgtgcagccc
aaggcggagcatgacgcttgggccgaccagaaactctgcacactgaggagaggtaactgc
agaggcagcgtgtgtgggcgagaccctaagtcccatttgtgcacctgtgcggagggatat
gctttaagcaaggacggaaagtactgtgaagatgtcaatgaatgtgccttttggaatcac
ggctgtactcttgggtgtgaaaacattgctggatcctattattgcacatgccctttaggg
tttgttctgcttcctgatgggaaacggtgtcaccaattaatttcctgtccaaacaatgca
tctgaatgcagccatggctgtgttctgacttcagatggtcccttgtgtttctgcccagaa
ggctcagtgcttgagacagatgggaaaacatgtagtggctgttcatcacctgataatggt
ggatgtagccaactctgccttgctctcagcccagtatcctgggaatgtggttgccttcct
gggtatgacctgcaactggacagaaaaagctgtgcagcttcaggaccacaaccacttttg
ctgtttgccaattctcaagatattcgacacatgcattttgatggaacagactatgtaacc
ctgctcagccaacaaatgggagcagtttttgccctcgatcatgaccctgtggaaaataag
gtatactttgcccatacggccctgaagtggatagagagagccaatatggatggttcccaa
cgagaaaggcttattgaggaagcagtggaagttccagaaggtcttgctgtagactggatt
gcccgtaaactctattggacagacggagggaaatctgtcattgaaggcagtgatttaaat
ggaaaacatcgtgaagtaatcattaaggaggacatctctcagccacgaggaatcgctgtt
catccaatggccaagagattgttctggactgatatggggattaatccacgaattgaaagt
tcttcccttcgaggcattggccgactggttattgccagctctgggctggtctggcccagt
ggaataacgattgatttcttaactgacaagttgtattggtgcgatgccaagcagtctgtg
attgaaatggccaatctggatggttccaaacgccaaagacttgtccagaacgatgtaggt
cgcccatttgctgtggctgtgtttgaggatcacgtgtggttctctgactggactgtgcca
tcggtaataagggtgaacaagaggactggcaaaaacagggtacgtctccgaggcagcatg
ctgaagccctcatcactggttgtagttcatccattggcaaaaccaggggcagatccctgc
ttatatcaaaacggaggctgtgcacacatttgcaaagaggagtttggaactgctcagtgt
tcgtgtcgtgaaggttttgtgaaggcctcagatgggaaaatgtgtctggctctaaatgtc
catcagatatcgacaggtagtgaagtagatctaagtaatcaagaaatgtcatcggactta
ttatccggcagtcaagggtctgaagataacactacacaatctcaacatatgcttgtggct
gaaatcatggtgtcagatgaagatgactgcggtcccatgggatgtggtgcacactctcaa
tgtgtcccagagggagaggtcgccacgtgtcagtgtttgagaggatttgctggggatgga
agagtatgttctgatgtagatgaatgtgacatgggtactgcagcttgcccgcacccctcc
tccgagtgcatcaacactgaaggtggctacgtgtgccggtgctcagaaggctaccaagga
gatgggactcattgccttgacattgatgagtgccaactgggcatgcacacctgtggggaa
aataccacctgtaccaatatggagggaaactacacctgcatgtgtgccagcagcctgtct
gaacctggacggaattgccctgactcgactccaccctctcatctcagggaggatggccgc
tactctgtgagaaatacttaccgagaatgtcccccgtcgcacgccgggtactgcctacac
ggcggtgtgtgcatgtacattgaatccgtggacacctacgcatgcaactgcgttgttggc
ttcgtgggggagcgctgtcagtaccgagacctgaggtggtgggaactgcgccatgctgac
caggggcggcggcagcggaacatcaccgtcgtggctgtctgcgtggtggcgcttgtcctg
ctgctgctcctggtgctgtggggcgctcgccactacaggactcagaagctgctatcgaaa
aatccagaaaacccttatgaagactcgaacagagaagtgagcgttagcaggcctgccgac
agagaggctgggacggcctcttgcccccagccttgggtaatgtga

DBGET integrated database retrieval system