KEGG   Desmodus rotundus (common vampire bat): 112296542
Entry
112296542         CDS       T05907                                 

Gene name
TRAF5
Definition
(RefSeq) TNF receptor-associated factor 5 isoform X1
  KO
K09849  TNF receptor-associated factor 5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04217  Necroptosis
dro04621  NOD-like receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04668  TNF signaling pathway
dro05163  Human cytomegalovirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112296542 (TRAF5)
   04668 TNF signaling pathway
    112296542 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112296542 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112296542 (TRAF5)
   04657 IL-17 signaling pathway
    112296542 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296542 (TRAF5)
   05203 Viral carcinogenesis
    112296542 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112296542 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112296542 (TRAF5)
   05168 Herpes simplex virus 1 infection
    112296542 (TRAF5)
   05163 Human cytomegalovirus infection
    112296542 (TRAF5)
   05169 Epstein-Barr virus infection
    112296542 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112296542 (TRAF5)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    112296542 (TRAF5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-TRAF_2 zf-C3HC4_4 DUF4941 zf-RING_UBOX zf-RING_6 zf-ACC zf-RING_2 DUF5753 Tropomyosin_1 Prefoldin DUF4279 Syntaxin-6_N zf_C2H2_13 Prok-RING_4
Other DBs
NCBI-GeneID: 112296542
NCBI-ProteinID: XP_024407119
LinkDB
Position
Unknown
AA seq 579 aa
MAYSEEQGGTPCGFIRQNSGNSISLDFEPNTEYQFVEPLEERYRCALCHSVLHNPHQTGC
GHRFCQHCILSLRELSAVPLCPVDKEVIKSQEVFKDNCCKREVLNLYVYCKNAPGCNAKI
ILGRFQQPPALSPGLAAASLPPCYLLQDHLQQCLFQVVPCSNENCGQPVLRKHLKEHLSA
YCQFREERCLYCKKDVVVINLQNHEENLCPKYPVSCPNKCLQIIPRTEVDEHLAVCPEAE
KGCPFQHYGCPVKGKRGSLQQHEHSALRDHLLLVLEKNVQLEEQISDLHKSLEQKESKIE
QLAETVNTFEKEFKQFAQLFGKNGSFLSNIQVLASHIDKSAWLEAQVRQLLQMASQQQDK
FDLRPLMEAIDTVQQKITLLESNDQRLVVLEGETHKHDVHINSHKAQLNRNEERFKLLEG
ACYTGKLIWKVTEYRVKKREALDGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHL
SLYFVVMRGEFDSLLQWPFKQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIA
SGCPRFVPHSTLENAKNTYIKDDTMFLKVAVDLTDLEDL
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggcttattctgaggagcaaggaggcaccccctgtggtttcatccgccagaattccggc
aactccatttccttggactttgagcccaacacagagtaccagttcgtggagccgctggaa
gagcggtacagatgcgccctgtgccactccgtgcttcacaacccccaccagacaggctgc
gggcaccgcttctgccagcactgcatcctatccctgagagaattaagtgcagtgccgctc
tgccctgtagataaggaggttatcaaatctcaggaggtgtttaaagacaattgctgcaaa
agggaagtcctcaatttatatgtgtattgcaaaaatgctcctggatgtaatgccaagatt
atcctgggacgattccagcagcccccagcgctctccccaggccttgccgccgcctccctc
ccaccctgttatctgttgcaggaccaccttcagcagtgcttgtttcaagttgtgccgtgt
tctaatgagaactgtgggcagccagtgcttcggaaacacctgaaagagcatttgagcgca
tactgccagtttcgagaggaaagatgcctttactgcaaaaaggacgtggtggtaatcaat
ctacagaatcacgaggaaaacttgtgtcccaagtacccagtgtcgtgtcccaacaagtgt
ctgcagattattcccagaactgaggtggatgaacaccttgccgtgtgtcctgaagcggaa
aagggctgtccttttcagcactatggctgtcccgtgaagggtaaacgggggagcctgcag
caacacgagcactcagccttacgggaccacttgctgctcgttttagaaaagaacgtccag
ttagaagaacagatttctgacttacataagagcctagaacagaaggaaagtaaaatcgag
cagctagcagaaactgtaaatacatttgaaaaggagttcaagcagtttgcacagctcttt
ggcaaaaacggaagcttcctctcaaacatccaggttcttgccagtcacatcgacaagtcg
gcttggctcgaagctcaagtgcgtcagttattacaaatggcaagccagcagcaagataaa
tttgatctgaggcctttgatggaagcgattgacacagtgcaacagaaaattaccctgcta
gaaagtaatgaccaaagattagttgttttggaaggggagacgcacaagcacgatgtccac
attaacagccataaagcacagctgaatagaaatgaagagcgatttaaactgctggaaggg
gcctgctataccggaaagctcatctggaaggtgaccgagtacagagtgaagaagcgagag
gcactggacgggcacacggtgtccatcttcagccagcccttctacaccagccgctgtggc
taccggctctgcgccagagcgtacctgaacggggacgggtccgggaaggggacgcacctg
tctctgtacttcgtggtgatgcgaggggagtttgactcactgttgcagtggcctttcaag
cagagggtaaccttgatgcttttggaccagagtggcaaaaagaaccacattgtggagacc
ttcaaggctgaccccaatagcagcagctttaaaagacccgacggggagatgaacattgcg
tcgggctgtccccgcttcgtgcctcactccactttggagaatgccaagaacacctacatt
aaagatgacaccatgttcttgaaagtggccgtggacttaactgacctggaggatctctag

KEGG   Desmodus rotundus (common vampire bat): 112303407
Entry
112303407         CDS       T05907                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6 isoform X1
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04064  NF-kappa B signaling pathway
dro04120  Ubiquitin mediated proteolysis
dro04140  Autophagy - animal
dro04144  Endocytosis
dro04380  Osteoclast differentiation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04722  Neurotrophin signaling pathway
dro05132  Salmonella infection
dro05133  Pertussis
dro05135  Yersinia infection
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05171  Coronavirus disease - COVID-19
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112303407 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112303407 (TRAF6)
   04064 NF-kappa B signaling pathway
    112303407 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112303407 (TRAF6)
   04140 Autophagy - animal
    112303407 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112303407 (TRAF6)
   04621 NOD-like receptor signaling pathway
    112303407 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    112303407 (TRAF6)
   04657 IL-17 signaling pathway
    112303407 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112303407 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112303407 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303407 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112303407 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112303407 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112303407 (TRAF6)
   05135 Yersinia infection
    112303407 (TRAF6)
   05133 Pertussis
    112303407 (TRAF6)
   05152 Tuberculosis
    112303407 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112303407 (TRAF6)
   05161 Hepatitis B
    112303407 (TRAF6)
   05160 Hepatitis C
    112303407 (TRAF6)
   05171 Coronavirus disease - COVID-19
    112303407 (TRAF6)
   05162 Measles
    112303407 (TRAF6)
   05168 Herpes simplex virus 1 infection
    112303407 (TRAF6)
   05169 Epstein-Barr virus infection
    112303407 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112303407 (TRAF6)
   05140 Leishmaniasis
    112303407 (TRAF6)
   05142 Chagas disease
    112303407 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112303407 (TRAF6)
   04121 Ubiquitin system [BR:dro04121]
    112303407 (TRAF6)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112303407 (TRAF6)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    112303407 (TRAF6)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    112303407 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 Tropomyosin_1 zf-RING_5 SlyX zf-TRAF_2 zf-RING_11 Spc29 DUF3450 DUF4455 DUF16 Filament KASH_CCD U-box AAA_13 UPF0242 ATG16 Anti-adapt_IraP Med21 EzrA TMF_DNA_bd DUF1664
Other DBs
NCBI-GeneID: 112303407
NCBI-ProteinID: XP_024414759
LinkDB
Position
Unknown
AA seq 563 aa
MYVCVKAFSSCCLYRAIDHLVTMSLLNCEDSCVSGQSESDCCAAMASACSAAAKDDSVSG
TASTGTLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSI
RDAGHKCPVDNEILLETQLFPDNFAKREILSLMVKCPNGGCLHKMELRHLEDHQVHCEFA
LTNCPQCQRPFQKCHLTIHILKECPRRQVSCINCAVSMAFEDKEIHDQNCPLANVVCEYC
NTMLIREQMPNHFDLDCPTAPIPCTFSTFGCHEKMQRIHLARHLQENTQSHMRMLAQAVQ
SLNLAVAPRPQRDMLPYESSSLPRISSGCHPEVQNFQETIQQLESRLVRQDHQIRELTAK
METQSIYVSELKRTIRSLEDKVAEIEAQQCNGIYIWKIGNFGMHLRSQEEEKPVVIHSPG
FYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSE
APIRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV
TTRFDMGSLRREGFQPRSSDAGV
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtatgtatgtgtgaaggcattttcttcttgctgtctctacagagcaattgaccatctc
gttactatgagtctgttaaactgcgaagacagctgtgtgtccggccagtctgagagtgac
tgctgcgcggccatggccagcgcctgcagtgccgcagccaaggatgacagtgtgagtggg
actgccagcacggggactctgtccagctctttcatggaggagatccagggctacgacgtg
gagtttgacccccccctggaaagcaagtacgagtgccccatctgcctgatggcattgcgg
gaagcagtgcaaacaccatgcggccacaggttctgcaaagcctgcatcatcaaatcaata
agggatgcaggtcacaaatgtccagttgacaatgaaatactcctggaaactcaactgttc
cctgacaactttgccaaacgagagattctttctctgatggtgaagtgtccgaatggaggt
tgtttgcacaagatggaactgagacaccttgaggatcatcaagtacattgtgagtttgct
cttacgaattgtccccaatgccagcgtcccttccaaaagtgccaccttactattcacatt
ctcaaggagtgtccaaggagacaggtttcttgtataaactgtgctgtgtcgatggcattt
gaagataaagagatccatgaccagaactgtcctttggcaaatgtcgtctgtgaatactgc
aacaccatgctcatcagggaacagatgcctaatcattttgatctagactgtcccacagcc
ccaattccatgcacattcagtactttcggttgccatgaaaagatgcagaggattcacttg
gcacgccacctacaagagaatactcagtcacacatgagaatgttggcccaggctgttcag
agtttaaaccttgccgtggctccccggcctcagcgtgacatgctgccgtacgagtcttcc
tccctgccccggatctcctctgggtgtcacccagaggtccagaatttccaagaaaccatt
caacaattagaaagtcgccttgtaagacaagatcatcaaatccgggagctgactgcgaaa
atggaaactcagagcatatatgtaagtgagctcaaacgaactattcgatcccttgaggac
aaagttgcggaaatagaagcgcagcagtgcaacgggatttacatctggaagattggcaac
tttgggatgcacttgagatctcaggaagaggagaagcctgtcgtcattcatagccctgga
ttctacacaggcaaacctgggtacaaactctgcatgcgcctgcaccttcagttaccgacg
gctcagcgctgtgcaaactatatatccctctttgtccacacgatgcaaggagagtatgac
agccacctcccttggcccttccagggcacaatacgcctcacaattcttgatcagtctgaa
gcccctataaggcaaaaccatgaggagataatggatgccaaaccagagctgcttgccttc
cagaggcccacaatcccacggaacccaaaaggttttggctacgtgacttttatgcatctg
gaagccctaagacaaagaaccttcattaaggatgatacgttattagtacgctgtgaggtc
actactcgtttcgacatgggtagtcttcgaagggagggttttcagccacggagtagtgac
gcaggggtatag

KEGG   Desmodus rotundus (common vampire bat): 112306448
Entry
112306448         CDS       T05907                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04064  NF-kappa B signaling pathway
dro04071  Sphingolipid signaling pathway
dro04141  Protein processing in endoplasmic reticulum
dro04210  Apoptosis
dro04217  Necroptosis
dro04380  Osteoclast differentiation
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04668  TNF signaling pathway
dro04920  Adipocytokine signaling pathway
dro04932  Non-alcoholic fatty liver disease
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05160  Hepatitis C
dro05163  Human cytomegalovirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112306448 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112306448 (TRAF2)
   04064 NF-kappa B signaling pathway
    112306448 (TRAF2)
   04668 TNF signaling pathway
    112306448 (TRAF2)
   04071 Sphingolipid signaling pathway
    112306448 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112306448 (TRAF2)
   04217 Necroptosis
    112306448 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112306448 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    112306448 (TRAF2)
   04657 IL-17 signaling pathway
    112306448 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112306448 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112306448 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112306448 (TRAF2)
   05203 Viral carcinogenesis
    112306448 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112306448 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112306448 (TRAF2)
   05014 Amyotrophic lateral sclerosis
    112306448 (TRAF2)
   05016 Huntington disease
    112306448 (TRAF2)
   05017 Spinocerebellar ataxia
    112306448 (TRAF2)
   05022 Pathways of neurodegeneration - multiple diseases
    112306448 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112306448 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112306448 (TRAF2)
   05135 Yersinia infection
    112306448 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112306448 (TRAF2)
   05160 Hepatitis C
    112306448 (TRAF2)
   05168 Herpes simplex virus 1 infection
    112306448 (TRAF2)
   05163 Human cytomegalovirus infection
    112306448 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112306448 (TRAF2)
   05169 Epstein-Barr virus infection
    112306448 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dro03019]
    112306448 (TRAF2)
   04121 Ubiquitin system [BR:dro04121]
    112306448 (TRAF2)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112306448 (TRAF2)
Messenger RNA biogenesis [BR:dro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     112306448 (TRAF2)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    112306448 (TRAF2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4_4 MATH
Other DBs
NCBI-GeneID: 112306448
NCBI-ProteinID: XP_024418188
LinkDB
Position
Unknown
AA seq 513 aa
MAAASVTPPGTLDALQFGFAKTVLGTKLEDKYLCSACKNVLRRPFQAQCGHRYCSFCLSS
ILSSGPQNCSACVHEGIYEEGISILESTSAFPDNAARREVESLPAICPSEGCTWKGTLKE
YESCHEGHCPFLLTECPACRGLVRLGEKERHAEQECPERSPSCRHCRAPCGGAGMKAHHE
VCPKFPLTCDGCSGKVPREKFQDHVRGCGECLAPCRFRDVGCPAMVEGEKQQEHEGQWLR
EHLAMLLRVLEARHPSQSQGRGQEAGVLGPGLELPAAAELLRRCEALERKTATFENIVCV
LNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVHEMEAS
TFDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRLYLNGDGTGRGTHLS
LFFVVMKGPNDALLRWPFNQKVTLMLLDQDNREHVIDAFKPDVTSSSFQRPVGDMNIASG
CPLFCPVSKMEAKNSYVRDDAVFIKAIVDLTGL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggctgctgccagtgtgaccccccctggcaccctggacgctctgcagtttggctttgca
aagaccgtcctggggaccaagctggaagacaagtacctgtgctccgcctgtaagaacgtc
ctgcgcaggcctttccaggcgcagtgtggccaccgctactgctcgttctgcctaagcagc
atcctcagctccgggccccagaactgctccgcctgtgtgcacgagggcatatacgaagaa
ggcatctcgattttagagagcacctcggctttcccagacaatgctgcccgaagggaggtg
gagagcctgccggccatctgccccagcgagggctgtacctggaaggggaccctcaaagag
tacgagagctgccacgaaggacactgcccattcctgttgaccgagtgcccggcgtgcaga
ggcctggtgcgcctcggcgagaaggagcggcacgccgagcaggagtgcccggagaggagc
cccagctgccggcactgcagggccccctgcggcggggctggcatgaaggcgcatcacgag
gtctgccccaagttccccctgacgtgtgacggctgcagcgggaaggtccctcgcgagaaa
tttcaggaccatgtcagggggtgtggcgagtgcctggcaccctgtcggttccgtgacgtc
ggctgccccgcaatggtggagggcgagaagcagcaggagcacgaaggccagtggctccga
gagcacctggccatgctgctgcgtgtcctggaggccaggcacccgtcccagagccagggg
cgtggccaggaggctggcgtgctgggcccgggcctggagctccctgcggcagcagagctc
ctgcgcaggtgtgaggccctggagaggaagacggccacctttgagaacattgtctgtgtc
ctgaaccgggaggtggagagggtggccatgactgccgaggcctgtggccggcagcaccgg
ctggaccaggaccggatagaagccctgagtaacaaggtgcagcagctggaaaggagcatc
ggcctgaaggacctggcaatggcggacctggagcagaaggtccacgagatggaggcatcc
accttcgatggggtgttcatctggaagatttcggacttcgccaggaagcgccaggaggcc
gtggcaggccgcatacctgccatcttctccccagccttctacaccagcaggtatggatac
aagatgtgtctgcgtttgtacctgaatggggacggcacagggcggggcacacacctgtcg
ctcttctttgtggtgatgaagggccccaatgacgccctcctgcgctggcccttcaaccag
aaggtgaccctgatgctgcttgaccaggacaacagagagcacgtgatcgacgccttcaaa
cccgacgtgacctcgtcctccttccagaggcccgtcggcgacatgaacattgcgagcggc
tgccccctcttctgccctgtctccaagatggaggccaagaattcctacgtgcgcgatgac
gctgtcttcatcaaggccatcgtggatctgacggggctctag

KEGG   Desmodus rotundus (common vampire bat): 112306476
Entry
112306476         CDS       T05907                                 

Gene name
TRAF1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04210  Apoptosis
dro04668  TNF signaling pathway
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112306476 (TRAF1)
   04668 TNF signaling pathway
    112306476 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112306476 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112306476 (TRAF1)
   05202 Transcriptional misregulation in cancer
    112306476 (TRAF1)
   05203 Viral carcinogenesis
    112306476 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112306476 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 112306476
NCBI-ProteinID: XP_024418226
LinkDB
Position
Unknown
AA seq 415 aa
MASGSASGPRPAPDENEFPFGCPPTACQDPPEPRALCCSACLSENLRNSEDRICPKCRGD
DPQSVSPGSLVSQEKDHPEVAADGVGCPFSGVGCSFKGSAKFMQEHEVTSQATHLNLLLE
FMNQWKAQLGAGLGSGPVALEQNLSDLQLQAAADVAGDLEVDCYRAPCSESQEELALQHS
MKEKVLADLEGKLRVFENIVAVLNKEVEASHLALAASIHQSQLDREHILGLEQRVMELQQ
TLAQKDQALDKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKY
GYKLCLRLYLNGDGTGKRTHLSLFIVIMKGEYDALLPWPFRNKVTFMLLDQNNREHAIDA
FRPDLSSVSFQRPQSETNVASGCPLFFPLSRLQSPKHAYVKDDTMFLKCIVETSA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcctctggctcagccagcggcccccgcccagcccctgatgagaacgagtttcccttt
ggatgcccccccactgcctgccaggacccaccagagcccagagccctctgctgctccgcc
tgtctctctgagaacttgaggaacagcgaggatcggatctgtcccaaatgcagaggagac
gacccccagtctgtaagcccaggaagtctcgtgtctcaggagaaggatcaccctgaggtg
gctgcagatggagtcgggtgccccttttcgggtgttggctgctccttcaaggggagtgca
aagttcatgcaggagcatgaggtcacctctcaggccacccacctaaacctgctgctggag
ttcatgaaccagtggaaggcccagctgggtgcaggcctggggtcggggcctgtggccctg
gagcagaatctgtcagacctgcagctgcaggcagctgcggacgtggctggggacctggag
gtggactgttaccgggccccctgctctgagagccaggaggagctggccctgcagcactcc
atgaaggagaaggtcctggccgacctggaggggaagctgcgtgtgtttgagaacattgtt
gcggtcctcaacaaggaggtggaggcctcccacctggccctggctgcctccatccaccag
agccagctggaccgcgagcacatcctgggcttggagcagagggtaatggagttgcagcag
acgctggcccagaaggaccaggccctggacaagctggagcagagcctgcggctcatggag
gaggcctccttcgatggcaccttcctgtggaagatcaccaatgtcaccaggaggtgccat
gagtcagcctgtggcaggactgtcagcctcttctccccagctttctacactgccaagtac
ggctacaagttgtgcctgagactctacttgaatggcgatgggacaggaaagaggacccac
ctgtcactcttcatcgtgatcatgaaaggggagtacgatgctctgctgccgtggcctttc
cggaacaaggtcaccttcatgctcctggaccagaacaaccgtgagcacgccattgatgcc
ttccggcctgacctgagctccgtgtccttccagcggccccagagtgaaaccaacgtggcc
agcggctgcccgctcttcttccctctcagcaggttgcagtcgcccaagcatgcctacgtg
aaggatgacaccatgtttcttaagtgcatcgtggagacaagtgcttag

KEGG   Desmodus rotundus (common vampire bat): 112308504
Entry
112308504         CDS       T05907                                 

Gene name
TRAF4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04657  IL-17 signaling pathway
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    112308504 (TRAF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112308504 (TRAF4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112308504 (TRAF4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-RING_5 zf-RING_2 zf-RING_6 zf-C3HC4_3 zf-TRAF_2 zf-rbx1 zf_Hakai
Other DBs
NCBI-GeneID: 112308504
NCBI-ProteinID: XP_024420547
LinkDB
Position
Unknown
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLSLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPTK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAFESHEGVCPQESVYCENKCGARMMRRLL
GQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPGHLK
DSCSTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVNRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggcttcgactacaaattcctggagaagcccaagcgacgattgctgtgcccgctg
tgcgggaagcctatgcgcgagcccgtgcaggtttctacctgcggccaccgtttctgcgac
acctgcctgcaggagttcctcagtgaaggagtcttcaaatgccctgaggaccagcttcct
ctggactatgccaagatctacccagacccagagctggaggtacaggtattgagcctgccc
atccgctgcatccacagcgaggagggctgccgctggagcgggccacttcgccacctacag
ggccacctgaacacctgcagcttcaatgtcgtcccctgccccaatcgctgccccaccaag
ctgagccgccgcgacctgcccgcacacttgcagcacgactgccccaagcggcgcctcaag
tgcgagttttgtggctgtgacttcagtggggaggcctttgagagccacgaaggcgtgtgt
ccccaagagagtgtgtactgtgagaacaagtgtggtgcccgcatgatgcgacggctccta
ggccagcatgccacctctgagtgtcccaagcgcacccagccttgcacgtactgcaccaag
gagttcgtcttcgacaccatccagagccaccagtaccagtgcccaaggttgcctgtgccc
tgccccaaccagtgtggtgtgggaaccgtggctcgggaggatctgccaggccatctgaag
gacagctgtagcactgccttggtgctgtgtccattcaaagactccggctgcaagcacagg
tgccctaagctggcaatggcgagacacgtggaggagagtgtgaagccccatctggccatg
atgtgtgccctggtgaaccggcagcggcaggagctgcaggagctgcgcagagagctggaa
gagctgtctgtgggcagtgacggtgtgctcatctggaagattggcagttatgggcgacgg
ctgcaggaagccaaagccaagcccaaccttgagtgctttagcccggccttctacacacat
aagtacggctacaagctgcaggtgtctgcgttcctcaatggcaatggcagtggtgagggc
acacatctctcgctctacatccgtgtgctgccgggtgcctttgacaatctccttgagtgg
ccctttgcccgccgtgtcaccttctccttgctggatcagagtgaccctgggctggccaag
ccacagcatgtcactgagacctttcaccctgacccaaactggaagaattttcaaaaacca
ggcacttggcggggctccctggatgagagttctctgggctttggttaccccaagttcatc
tcccaccaggatatccgcaagcgaaactatgtgcgggatgatgcggtcttcatccgtgcc
tcagttgaattaccccgaaagatcctcagctga

KEGG   Desmodus rotundus (common vampire bat): 112311693
Entry
112311693         CDS       T05907                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04668  TNF signaling pathway
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05171  Coronavirus disease - COVID-19
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112311693 (TRAF3)
   04668 TNF signaling pathway
    112311693 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112311693 (TRAF3)
   04621 NOD-like receptor signaling pathway
    112311693 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    112311693 (TRAF3)
   04657 IL-17 signaling pathway
    112311693 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311693 (TRAF3)
   05203 Viral carcinogenesis
    112311693 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112311693 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112311693 (TRAF3)
   05160 Hepatitis C
    112311693 (TRAF3)
   05171 Coronavirus disease - COVID-19
    112311693 (TRAF3)
   05164 Influenza A
    112311693 (TRAF3)
   05162 Measles
    112311693 (TRAF3)
   05168 Herpes simplex virus 1 infection
    112311693 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112311693 (TRAF3)
   05169 Epstein-Barr virus infection
    112311693 (TRAF3)
   05165 Human papillomavirus infection
    112311693 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 zf-C3HC4_2 Crescentin MPS2 Spc7 Sina Spc29 KxDL Cast Tropomyosin_1 T3SSipB Fib_alpha GAS FliJ BLOC1_2 DUF1664 DUF3450 Exonuc_VII_L LMBR1
Other DBs
NCBI-GeneID: 112311693
NCBI-ProteinID: XP_024423890
LinkDB
Position
Unknown
AA seq 566 aa
MEPSKKTDASGPLQTNPPLRLHPDRGAPVLVPEQGGYKERFVKPVEDKYKCEKCRLVLCN
PKQTECGHRFCDSCMASVLSSSGPKCTACQEGIAKDKVFKDNCCKREILALQIYCRNEGR
GCAEQLTLGHLLVHLKNDCQFEELPCVRADCKERVLRRDLRDHVDKACKYREATCSHCKS
QVPMITLQRHEDTDCPCVAVSCPHKCRVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQ
GTNQQIKAHEASSAVQHVNLLKEWSSSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEI
ERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVT
ELESVDKSSGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKI
RDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEY
DALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTV
LENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggagccgagtaaaaagacagacgcctcgggcccactgcagaccaacccgccgctcagg
ctgcaccccgaccgcggagcgcccgtgctggtccccgagcagggcggctacaaggagcgc
ttcgtgaagcccgtggaagacaagtacaagtgcgagaagtgccggctggtgctgtgcaac
ccaaagcagaccgagtgtgggcaccgcttctgcgacagctgcatggcctccgtgctgagc
tcctcgggcccaaagtgtacggcgtgtcaagaaggcatcgcgaaagataaggtgttcaag
gacaattgctgcaagagggagatcctggcccttcagatctactgcaggaacgagggccgc
ggctgtgcggagcagctgacactgggccacctgctggtgcatttgaagaatgattgccag
tttgaagaactgccgtgcgttcgtgccgactgcaaagaacgggtcctgaggagagacctg
cgtgaccacgtggacaaggcctgtaaataccgagaggccacgtgcagccactgcaaaagc
caggtccccatgatcacgctgcagagacacgaagacacggactgtccctgcgtggctgtg
tcctgccctcacaagtgcagagtccagaccctcctgcggagcgagttgagtgcgcacttg
tcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtttttcag
gggacaaaccagcagatcaaggcccacgaggccagctccgcggtgcagcacgtcaacctc
ctgaaggagtggagcagctctctcgagaaaaaggtttccttgctgcagaatgaaagtgtg
gagaaaaacaagagcatccagagcctgcacaaccagatatgtagcttcgaaattgagatc
gagagacagaaggaaatgcttcgaaataatgaatccaaaatacttcatttacagcgagta
atagacagccaagcagagaaactgaaagagctcgacaaagagatccgccccttccggcag
aactgggaggaagcagacagcatgaagagcagcgtggagtcgctccagaaccgagtgacc
gagctggagagtgtggacaaaagctcggggcaggcagcccgaaacacaggcctgctggag
tcgcagctgagccggcacgaccagatgctgagcgtgcacgacatccgcctggccgacatg
gacctgcggttccaggtgctggagaccgccagctacaacggggtgctcatctggaagatc
cgcgactacaagcggcggaagcaggaggcagtcatggggaagacactgtccctgtacagc
cagcccttctacaccggctacttcggctacaagatgtgcgcccgggtctacctgaacggg
gacggcatggggaaggggacgcacctgtcactctttttcgtcatcatgcgtggcgagtac
gacgccctgctcccgtggcccttcaagcagaaggtgacactcatgctgatggaccagggg
tcgtctcggcgccacctgggggacgcgttcaagccagaccccaacagcagcagcttcaag
aagcccaccggggagatgaacatcgcctccggctgcccggtctttgtggcgcagactgtg
ctagaaaacgggacgtacattaaagacgacaccatctttattaaagtcatagtggatact
tcggacctgcccgacccctga

DBGET integrated database retrieval system