KEGG   Desmodus rotundus (common vampire bat): 112296707
Entry
112296707         CDS       T05907                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00590  Arachidonic acid metabolism
dro01100  Metabolic pathways
dro04064  NF-kappa B signaling pathway
dro04370  VEGF signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04668  TNF signaling pathway
dro04723  Retrograde endocannabinoid signaling
dro04726  Serotonergic synapse
dro04913  Ovarian steroidogenesis
dro04921  Oxytocin signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro05010  Alzheimer disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05140  Leishmaniasis
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05200  Pathways in cancer
dro05204  Chemical carcinogenesis
dro05206  MicroRNAs in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112296707 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112296707 (PTGS2)
   04064 NF-kappa B signaling pathway
    112296707 (PTGS2)
   04668 TNF signaling pathway
    112296707 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112296707 (PTGS2)
   04657 IL-17 signaling pathway
    112296707 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    112296707 (PTGS2)
   04913 Ovarian steroidogenesis
    112296707 (PTGS2)
   04921 Oxytocin signaling pathway
    112296707 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    112296707 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    112296707 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296707 (PTGS2)
   05206 MicroRNAs in cancer
    112296707 (PTGS2)
   05204 Chemical carcinogenesis
    112296707 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112296707 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112296707 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    112296707 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112296707 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112296707 (PTGS2)
   05165 Human papillomavirus infection
    112296707 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112296707 (PTGS2)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     112296707 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF
Other DBs
NCBI-GeneID: 112296707
NCBI-ProteinID: XP_024407255
LinkDB
Position
Unknown
AA seq 604 aa
MLSRALLLCAALALGAAGNPCCSNPCQNQGVCMSVGFDHYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYMLTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSEVIVDKFIIRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDLKRGPAFTKGLGHGVDLNHVYGETLERQHKLRLFKDGKLKY
QIIDGELYPPTVKDTQAKMLYPPHIPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLRQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDSFQIDDQEYNYQQFLYNNSLLMEHGLTQFVESFSKQIAGRV
SGGRNLPAAVRYVAKTSIDHSRQMRYQSLNEYRKRFRMKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEEPRQGAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEE
GFQIINTASIQSLICNNVKGCPSTSFSVQDPQPTKTVTMNSSPSHSRLDDINPTVLLKGR
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgctctcccgcgccctgctgctctgcgctgcgctggcgctcggcgctgcaggaaatcct
tgctgttccaacccatgtcaaaaccaaggtgtgtgcatgagtgttggatttgaccactat
aagtgtgactgtacccgaacaggattctacggggaaaactgttcaacacctgaatttctg
acaagaataaaattattcctgaaacccacgccaaacacagtgcactacatgcttacccac
ttcaagggggtctggaacattgtcaataatattcccttcctgagaaatgcaatcatgaaa
tatgtgctaacatccagatcccatttgattgacagcccaccaacttacaatgcacactat
ggctacaaaagctgggaagccttttctaacctctcctattataccagagctcttcctccc
gtggctgatgattgcccaactcccatgggggtgaaagggaaaaaagagcttcctgactca
gaagtgattgtggataaatttataataagaagaaagtttattccggatcctcagggcacg
aatttgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatctt
aagcgtgggccagccttcactaaaggactgggtcatggggtggacttaaatcatgtttat
ggtgaaactttggagagacagcataaactgcgccttttcaaagatggaaaactgaaatat
cagataattgatggagagctatatcctcccacggtcaaagacactcaggccaagatgctc
tacccacctcacatccctgaacacctgcagtttgctgtggggcaggaggtgtttggcctc
gtgcctggtctgatgatgtatgccacgatttggctgcgagaacataaccgagtgtgtgat
gtgctgagacaggagcatccggaatgggatgatgagcagttgttccagacaagcaggcta
atactgataggagaaactattaagattgtgatcgaagactatgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgctgttcaaccaacagttccagtaccaa
aaccgcattgccgccgagttcaacacgctctaccactggcaccccctcctgcctgacagc
tttcagattgatgaccaggagtacaactaccaacagtttctctacaacaactctttacta
atggaacacgggctcacccagtttgttgagtcattcagcaagcaaattgctggccgggtt
tctggcggccggaaccttccagctgcagtccggtacgtggcaaagacctccatcgaccac
agcagacagatgagataccagtctctcaacgagtaccgcaagcgctttcggatgaagccc
tatgaatcctttgaagagcttacaggagagaaggaaatggcagcggagctggaagcgctc
tatggtgacatcgacgccatggagctgtaccccgcccttctggtggaagagccccgtcag
ggtgccatctttggtgagaccatggtagaactcggagcccctttctccttgaaagggctg
atgggcaatcccatatgttctcctcaatactggaagcctagcaccttcggtggagaagaa
ggctttcaaatcatcaacactgcctccattcagtctctcatatgcaataacgtgaaaggc
tgcccctccacctcgttcagcgttcaggacccgcagcccaccaagaccgtcaccatgaac
tcgagcccctcccactccagactggatgatatcaaccccaccgtactactaaaaggacgt
tcgaccgaactgtag

DBGET integrated database retrieval system