KEGG   Desmodus rotundus (common vampire bat): 112296770
Entry
112296770         CDS       T05907                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112296770 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112296770 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112296770 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296770 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112296770 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112296770 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112296770 (LAMC2)
   05145 Toxoplasmosis
    112296770 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 112296770
NCBI-ProteinID: XP_024407322
LinkDB
Position
Unknown
AA seq 1191 aa
MPALWLSCCLCVSLLLPAARATSRREVCDCNGRSQKCVFDQELHRRTGNGFRCLHCSDNT
AGTHCERCKEGFHRQRERDRCLPCNCHSKGSLSARCDNSGRCSCKPGVTGDRCDRCLPGF
HTLTDAGCTQDQRLLDPKCDCDPAGISGPCDTGRCVCKPAVTGERCDRCRPGYYHLDGGN
PEGCTQCFCYGHSASCRSSADYSVHKITSDFHQDVDGWKAVQRNGSPAKLHWSQRHRDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRVTAPL
MPLGKTLPCGITKTYTFRLNEHPSSTWSPQLSYFEYRRLLRNLTALWIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCVCPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGTCDPDTGDCYSGDENPDVECADCPLGFYNDPHDPRSCKPCPCRNGFSCSVMPETEEVV
CNNCPLGVTGARCELCADGYFGDPFGERGPVRPCQPCQCNSNVDPSASGNCDRLTGRCLK
CIHNTAGVYCEQCKAGYFGDPLAPNPADKCRACNCNPSGSEPVECRSDGSCVCKPGFGGL
HCEHAALTRCPACYDQVKGQMDQFAQQLRSLEALVAKAAAGGGGAPNAELEARMQQAEQA
LRDILREAQISEGTMRSLNVQLTKARSQENSYRNRLDDLKRTVERVQALGGQYENRVQDT
RRLITQMRLSLEEGESSLGNTNIPPSDHYVGPNSFQNLAQEAMRLADSHEESANNMERLA
GETEDYSKQALSLARKALQEGGGSGSLDGPVVHGLMRKLEKTKSLAQQLSREAAHTDIEA
EKSYQHSLRLLNSASQLQGVSDQSLQVEAKRIRQKADSLSSLVTKHMDEFKRMQSNLGNW
EEETRQLLQNGKNERQKSAQLLSRANLAKRRAQEALSMGNATFYEVENILKNLREFDLQV
GDRKAEAEEAMKRLSYISQKVADASDKTEQAEAALGGAAADAQGAKNAAREALEITGKIE
QEIGGLNLEANVTADGALDMEKGLAALKSGMREVEGELARKEQEFDMDMDMVQRVISEAQ
RVGNRAKNAGVTIQATLDTLDSILHLIDQPGGVNEEGLILLEQKLSRAKTQINSQLRPLM
SELEERASRQRGHLHVLETSIDGILADVKNLENIRDNLPPGCYNTQALEQH
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctcagctgctgcctctgcgtctccctgctcctgcctgccgcccgg
gccacctccaggagggaagtctgtgattgcaatgggaggtcccagaaatgcgtctttgat
caggaacttcacaggcggaccgggaacggattccgctgcctccactgcagcgacaacact
gccggcactcactgcgagcggtgcaaggaggggtttcaccggcagagagagagagaccgc
tgtttaccctgcaactgccactccaaaggttctcttagtgctcgatgtgacaactctgga
cggtgcagctgtaagccaggtgtgacaggagacaggtgtgaccgatgtctgccaggcttc
cacacactcacagatgccggctgcacccaagaccaaaggctactagaccccaagtgtgac
tgtgacccagctggtatctcggggccctgtgacacgggccgctgtgtctgcaagccagct
gtcacgggagagcgctgtgataggtgtcgaccaggttactaccacctggatggcggaaac
cctgagggctgtacccagtgtttttgctacgggcactcagccagctgccgcagctctgcg
gactacagtgtccataaaatcacctcggacttccatcaagatgttgatggctggaaggct
gtccaaagaaatgggtctcctgcaaagctccactggtcccagcgccaccgggacgtgttc
agctcagcacgacggtctgaccctgtctactttgtagctcctgccaaatttcttgggaat
caacaagtgagctatggacaaagcctgtcctttgactaccgtgtggacaggggaggcaga
cacccatcggcccacgacgtgatcctggaaggcgctggtctacgggtcacagcccccttg
atgccgcttggcaagacgctgccttgtgggatcaccaagacttacacgttcagattgaat
gagcatccaagcagtacttggagcccccagctgagttactttgagtatcggaggttgctg
cgcaacctcaccgccctgtggatccgagccacctacggggagtacagcactgggtacatt
gacaacgtgaccctgatttcagcccgccccgtctctggagccccagcgccctgggttgaa
cagtgtgtgtgtcctgttgggtacaagggacagttctgccaggattgtgcttctggctac
aaaagagactcagccagattgggaccctttggcacctgtattccatgtaactgccaaggg
ggagggacctgcgatccagacacaggagactgttactccggggatgaaaatcctgacgtg
gagtgtgccgactgccccctcggtttctacaacgacccgcacgacccccgaagctgcaag
ccgtgcccctgtcgcaatgggttcagctgctcggtgatgcccgagacagaggaggtcgtg
tgcaataactgccccctcggggtcactggtgcccgctgcgagctctgtgccgacggctac
tttggggacccctttggggaacgtggccccgtgaggccttgtcagccctgccagtgtaac
agcaacgtggaccccagtgcctccgggaactgtgaccgcctgacaggcaggtgtctcaag
tgcatccacaacacagccggagtctactgtgagcagtgcaaagcgggctactttggggac
cccctggctcccaacccagcggacaagtgtcgagcctgcaactgtaacccatctggctcc
gagcctgtggagtgtcgcagtgacggcagctgcgtctgcaagccaggatttggtggcctc
cactgtgagcatgcggcgttaaccagatgtccagcttgctacgatcaagtgaagggtcag
atggatcagtttgcccagcagctgcggagcctggaggccctggttgcgaaggctgcggcg
ggtggcggaggagcacccaatgcagagctggaagccaggatgcagcaggctgagcaggcg
cttcgggacattctcagagaggcccagatttcagaaggtactatgaggtctctcaatgtc
cagctgaccaaggcaaggagccaagaaaacagctaccggaaccgcctggatgacctcaag
aggactgtggaaagggttcaggccctgggcggtcagtatgagaaccgagtgcaggatact
cgaaggctcatcactcagatgcgcctgagcctcgaggagggcgaatcttccctgggaaac
acaaacatccctccctcggaccactacgtggggccaaatagctttcaaaacctggctcag
gaggccatgagattggcagacagccatgaggagtcagccaataacatggagcgactggca
ggggaaaccgaagattattccaaacaagctctgtcactggcgcgcaaggcacttcaggag
ggaggtggcagcggcagcctggacggccccgtggtgcacgggctgatgcgaaaattggag
aaaaccaaatctctggcccagcagttgtccagggaggctgctcacacggatattgaagcg
gagaagtcttatcaacacagtctccgcctcctcaattccgcgtctcagcttcagggagtc
agtgatcagtccttgcaggtagaagcaaagaggatcagacaaaaagctgattctctctcc
agcctggtgacgaagcatatggatgaattcaagcgtatgcaaagcaacctgggaaactgg
gaagaagaaacccggcagctcttacagaatggaaagaatgagagacagaagtcggctcag
ctgctttcccgtgccaaccttgctaaaagaagagcccaagaagcactaagtatgggcaat
gctactttttatgaagttgagaacatcttaaagaacctcagagagtttgacctgcaggtt
ggagacagaaaagcagaagctgaagaggccatgaagagactgtcctacatcagccagaag
gttgcagacgccagtgacaagactgagcaagcagaagcagccctgggtggtgcagctgct
gacgcccagggggcaaagaacgcggccagggaggccctggagatcaccggcaagatagaa
caggagatagggggcctgaacttggaagccaatgtgacagcagatggagccttggacatg
gagaagggactggccgctctcaagagtgggatgagggaagtggaaggagagctggccagg
aaggagcaggagttcgacatggacatggacatggtgcagagggtaatttcagaggctcaa
agagttggtaacagagccaagaatgctggagtcacgatccaagccacactcgacaccttg
gacagcatcctacatctaatagaccagcccggcggtgtgaatgaagaggggctgatttta
ttggagcagaagctttccagagccaaaactcagatcaacagccagctgcggcccttgatg
tcagagctggaagagagggcgagtcggcagaggggccacctccatgtgctggagaccagc
atagatgggattctggctgatgtaaaaaacttggagaacattagggacaacctgccccca
ggctgctacaacacccaggctcttgagcaacactga

KEGG   Desmodus rotundus (common vampire bat): 112296845
Entry
112296845         CDS       T05907                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04974  Protein digestion and absorption
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112296845 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112296845 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112296845 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112296845 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    112296845 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296845 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112296845 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112296845 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112296845 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112296845 (COL4A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112296845 (COL4A5)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112296845 (COL4A5)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112296845 (COL4A5)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112296845 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112296845
NCBI-ProteinID: XP_024407383
LinkDB
Position
Unknown
AA seq 1687 aa
MRIKRRGVSRAAGLFLLALSLWGHPAEAAACYGCSPGSKCYCSAVKGEKGEKGFPGLEGH
PGLPGFPGPEGPPGPRGQKGDGGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGP
QGIPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIISSLPGPKGNPGHPGP
PGVQGPAGPVGVPGPIGPPGPPGLMGPPGPPGSPGPKGNMGLNFQGPKGEKGEQGLQGPP
GPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGMRGPPGPSGGVKGEKGEQGEPGKRG
KPGKDGENGHPGIPGLPGDPGYPGGPGRVGEKGQKGDTGPPGPPGFVIPRPETGVTVGEK
GNMGFPGLPGEKGEQGFPGIQGPPGLPGPPGIAVMGPPGPPGFPGERGQKGDEGPPGISF
PGSPGLDGKPGVPGLPGPPGPPGPHIPPRDEICEAGPPGPPGSPGDRGLQGEQGMKGDKG
DTCFNCIGAGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGHTGAAGPKGLRGIPGAPGAP
GFPGPKGEPGDILTFPGMKGDKGQLGFPGPPGLPGLPGTPGQDGLPGLPGPKGEPGGIAF
KGERGPPGNPGLPGLPGNRGPMGPLGIGSPGPVGEKGIKGVVGNPGQPGIPGPKGNPGRT
ITRPGKPGLPGMPGRDGGVGPQGDPGLPGQPGLPGIPGTKGEPGIPGIGLPGPPGPKGFP
GIPGPPGAPGTPGRMGLEGPSGPPGFQGPKGEPGFGLPGPPGPPGLPGFKGTLGPKGDRG
FPGPPGTPGRTGLDGLPGPKGDIGPRGQPGPMGPHGLPGIGVQGPPGPPGIPGPIGLPGL
HGIPGEKGDPGPPGFDVPGPPGERGSPGIPGAPGPLGPPGLPGPPGKVGASGLPGTKGEM
GMMGPPGPPGPLGIPGRSGAPGLKGDDGLQGQPGFPGPTGEKGSKGEPGLPGPPGPMDPE
LLGSKGEKGDPGLPGIPGVPGPKGYQGLPGDPGQPGLSGKPGLPGLPGPQGDPGLPGKSG
LTGPPGLKGNTGDMGFPGPQGVKGFAGTPGVPGQPGSPGLPGQKGEKGDPGVSGIGLPGL
PGPKGEPGLPGYPGNPGIKGSVGDTGLPGLPGTPGAKGQPGLPGFPGTPGLPGPKGITGP
PGNPGLPGESGPVGGRGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGVPGPPGLP
GLSGQKGDGGLSGIPGNPGLPGQKGEPGFPGFPGVQGPPGPPGSPGPALEGPKGNPGPQG
PPGRPGLPGPEGPWGLPGNGGIKGEKGNPGQRGQSGLPGLKGDQGPPGLQGNPGRPGLNG
MKGDPGLPGVPGFPGMKGPSGLPGSTGPDGDPGLIGPPGPPGLPGPSGQSIVIKGDAGPP
GVPGQPGFKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGARGRKGDPGLPGQPGTRGLD
GPPGPDGLQGPPGPPGTSSITHGFLITRHSQTTDAPQCPQGTVQIYEGFSLLYVQGNKRA
HGQDLGTAGSCLHHFSTMPFMFCNINNICNFASRNDYSYWLSTPESMPMNMEPLKGQSIQ
PFISRCAVCEAPAVVIAVHSQTIQIPRCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPG
SCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKTGDLTTRISRC
QVCMKRT
NT seq 5064 nt   +upstreamnt  +downstreamnt
atgagaataaaacgtcgtggagtcagccgggctgcaggcttgttcttactggccctgagt
ctttggggacacccagcagaggctgcggcttgctatgggtgttctccaggatcaaagtgt
tactgtagtgctgtaaaaggagaaaagggggagaaaggatttccaggtttggaaggccat
ccaggtttgcctggatttccaggtccagaagggcctccagggcctcgaggacaaaagggt
gatggtggaattccagggccaccaggaccaaaaggaatcagaggtcctcctggacttcct
ggatttccagggacaccaggtcttccaggaatgccaggccatgatggggcaccagggcct
caaggtatccctggatgcaatggaaccaagggagaacgtggatttccaggcagtcccggt
tttcctggtttacagggtcctccaggacctcctgggattccaggtatgaagggagaacca
ggtagtataattatatcatcactgccaggaccaaagggtaacccaggacatccaggtcct
cctggagtacaaggcccagctggtcctgttggtgtaccagggccaattggtcctccagga
ccaccaggcttgatgggccctcctggtccaccaggaagtccaggaccaaagggaaatatg
ggcttaaatttccaaggacccaagggtgaaaagggtgagcaaggtcttcagggccctcct
gggccacctggccagatcagtgaacagaaaagaccaattgatgtagagtttcagaaagga
gatcagggacttcctggtgaccgagggcctcctggacctccagggatgcgtggtcctcca
ggtccttcaggtggtgtgaaaggtgagaagggtgagcaaggagaacctggcaaaagaggt
aaaccaggcaaagatggagagaatggccatccaggaattccaggtttgcctggtgatcct
ggttaccctggtggaccaggaagggttggagaaaagggccaaaaaggtgacactggccca
cctggcccacctggatttgtaattcctaggcctgagactggtgtaactgtaggagaaaaa
ggaaacatggggtttcctggcttgcctggagaaaaaggagagcaaggatttcctggaata
cagggtccacctggccttcctggacctccagggattgcagttatgggtcctcctggtccc
cctggctttcctggagaaagaggacagaaaggagatgaaggtccacctggaatttccttt
cctggatctcctggacttgatggaaagcctggggttcctggccttccagggcctcctgga
cctccaggtcctcacatccctcctagagatgagatatgtgaagcaggccccccaggcccc
ccaggatctccaggtgatagaggactccaaggagaacaaggaatgaaaggtgacaaaggt
gacacctgcttcaactgtattggagctggtatttcagggcctccaggtcaacctggtttg
ccaggtcttccaggtcctccagggtctcttggttttcctggacagaagggtgaaaaagga
cacactggcgcagctggtcccaaaggactaagaggcataccaggagctccaggtgctcca
ggctttcctggacctaaaggagaacctggtgacatcctcacttttccaggaatgaaaggt
gataaaggacagttgggtttccctggacctccaggtctccctggtttacctggcacccct
ggacaagatggattgccagggctacctggccccaaaggagaacctggtggaattgctttt
aagggtgaaagaggtccccctgggaacccaggtttgccaggtctcccagggaataggggg
cctatgggccctcttggtattggctctccaggcccagtaggtgaaaaaggcataaaaggt
gtggtgggaaatccaggccagccaggaataccaggtcctaaaggtaatccaggtcggacc
ataacccggccaggaaagcctggtctgcctggtatgccaggcagggatggtggagtaggt
cctcaaggtgaccctggactcccaggccagccgggtttgccaggaataccaggtaccaaa
ggagaaccaggtattcctggaatagggcttcctggaccacctggtcccaaaggttttcct
ggaattccaggacctccaggagcacctggtacacctggaagaatgggtctagaaggccct
tctgggccaccaggctttcaaggaccaaagggagaaccagggtttgggttacctgggcca
ccagggcctccaggacttccaggtttcaaaggaacacttggcccaaaaggagatcgtggt
ttcccaggacctccaggcactccaggacgcactggattggatgggctacctggaccaaaa
ggtgacattggaccacgtggacaacctgggccaatgggaccgcatgggctaccaggaata
ggtgttcagggaccaccagggccaccagggattcctggaccaataggcctacctggcttg
catggaataccaggagagaagggggatcctggccctcctgggtttgatgttccaggaccc
cctggtgagagaggcagtccagggatccctggagcgcctggtcctctgggacccccagga
ttgccagggcctccaggaaaagtaggtgcctctggattaccaggtaccaaaggtgaaatg
ggtatgatgggacctccaggcccaccaggacctttgggaattcctggtaggagtggtgct
cctggtctcaaaggtgatgatggtttgcagggtcagccagggtttcctggtcctacagga
gaaaaaggtagtaaaggggaacctggacttcctggccctcctggaccaatggatccagag
ctgctgggctcaaaaggagaaaagggggaccctggtttaccaggtattcctggagtgcca
gggccaaaaggttaccagggtttgcctggagacccaggacagcctggactgagtgggaaa
cctggattaccaggactaccaggtccccagggtgatcctggtctccctgggaagtcagga
cttacaggacccccaggacttaaaggaaacacaggtgatatgggttttccaggccctcag
ggtgtgaaagggttcgctggtactcctggagttcctggacaacctggctccccaggatta
cctggacagaaaggagaaaaaggtgatcctggtgtttcaggcattggtcttccaggtctt
cctggcccaaagggtgaacctggtctgcccgggtacccagggaaccctggcatcaaaggt
tctgtgggagatactggtttgcctggattaccagggacccctggagcaaaaggacaacca
ggtcttcctggattccctggaacccctggccttcctggaccaaaaggtatcactggtcct
cctgggaaccctggacttccgggagaatctggccctgtaggtggcagaggtcgtcctggg
ccaccgggacccccaggtgaaaaagggaaaccaggtcaagatggtattcctggaccagct
ggacagaagggtgaaccaggtcaaccaggctttggagtcccaggaccccctggactccca
ggactttctggtcaaaagggtgatggaggattatctggcattccaggtaaccctggcctt
ccaggtcaaaagggtgaaccaggctttcctggtttccctggtgtgcagggtccccctggc
cctcctggttctccaggtccagctctagaaggccctaaaggcaaccctgggccccaaggt
cctcctgggagaccaggtctaccaggtccagaaggtccctggggtctccctggaaatgga
ggtattaaaggagagaaaggaaacccaggtcaacgtgggcaatctggtttgcctggtttg
aaaggagatcaaggaccaccaggactccagggtaatcctggccggccaggtctcaatgga
atgaaaggagatcctggtctccctggtgttccaggatttccaggcatgaaaggacccagt
gggctgcctggttcaactggccctgatggagatccaggacttattgggcccccaggtccc
cctggattacctggtccttcaggtcagagtattgtaatcaaaggagatgctggtccacca
ggggtcccaggccagcctggatttaaaggtctaccaggactaccaggacctcaaggatta
ccaggtccaattggccctccaggagatcctggacgcaatggactccctggctttgatggg
gcaagagggcgtaaaggagacccaggtctgccaggccagccaggtacccgtggtttggat
ggcccccctgggcctgatggattgcaaggtcccccaggaccccctggaacttcttctatt
actcatggattcctcatcacacgtcacagccagacaacagatgcaccacagtgcccacag
ggaactgtccagatttatgaaggcttttctctcttatatgtacaaggaaataaaagagct
cacggtcaagacttggggacagctggcagctgccttcatcatttcagtaccatgcctttc
atgttctgcaacatcaacaacatttgtaactttgcttcaagaaatgactattcttactgg
ctctccactccagagtccatgccaatgaacatggagcccctgaagggccagagcattcag
ccattcattagtcgatgtgcagtgtgtgaagctccagctgtggtgattgcagttcacagt
cagaccatccagattccccgttgtcctcagggatgggattctctctggattggttattcc
ttcatgatgcacacaagtgctggggcagaggggtcaggtcaagccctggcctcccctggt
tcttgcttggaagagtttcgttcagcgcccttcattgaatgccatgggcgaggtacctgc
aactactatgccaattcctacagcttttggctggcaactgtagatgtatcagacatgttc
agcaaacctcagtcagaaacgctgaagacaggagacttgacaacacgtattagccgatgt
caagtatgcatgaagaggacataa

KEGG   Desmodus rotundus (common vampire bat): 112296867
Entry
112296867         CDS       T05907                                 

Gene name
COL4A6
Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-6(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04974  Protein digestion and absorption
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112296867 (COL4A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112296867 (COL4A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112296867 (COL4A6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112296867 (COL4A6)
  09154 Digestive system
   04974 Protein digestion and absorption
    112296867 (COL4A6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296867 (COL4A6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112296867 (COL4A6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112296867 (COL4A6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112296867 (COL4A6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112296867 (COL4A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112296867 (COL4A6)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112296867 (COL4A6)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112296867 (COL4A6)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112296867 (COL4A6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112296867
NCBI-ProteinID: XP_024407405
LinkDB
Position
Unknown
AA seq 1653 aa
MLGIREGRVGQPGQIGIQGPTGPQGFAGPSGLSGLKGERGSPGPLGLYGPKRDKGPMGVP
GFLGINGILGHPGQPGPXGPRGLDGCNGTQGAVGFPGPDGYPGVLGPPGLPGQKGCKGEP
VLTEGHFKGMKGDPGLPGLDGITGPRGPPGSPEAVEPIGSPRFQVSPPGPPGLPGLDGNM
GLGFQEDKVKGDVGLPGSAGHPPSTGELEFMGFPKGKKXSKGEPGLPGFPGTSGRPGRPG
FGTAEEKGEKGIPGLPGPRGPMGLPGVQGPPGSQGKKGSSGFPGLNGLPGIKGGKGGIGL
PGPDVHIDTGGAVISGYPGDPSIPDIPGLEGDEGIQGLPGFPGLPGLPAIPGVPGALGPQ
EVPGLKGNKGNPGHTTIGAAGLPGKDSLPGVPGLPGPAGPAFEPGTVQNTEPGFSGLQGE
RSPKGNQGLKGVKGDLGFCACDGCSLPHTGPPGKPGHIGLPGLKGARGDPGSGGTQGPSG
SPGLFGPQGPTGPKGEKGESTLSIRSGMPGEQDDPGFPGVPGETGVPGKNGIPGLPGLPG
FPGDVGQGFPGEKGLPGLPGEKSLSGPPGFPGTGLPGSPGXCGLPGDQXIDGFPGKPGIP
GPAGDCCCRDKVGKGDLDTEGGITLPCIIPGPYSPSGFPGAPGFSGPKGARGLPGTLGRP
GFCGNKGEPGSPGSVQLTTFQPGFPGPNGEKGLPGFPGLPGKDGLPDKVGNPSLPGSKGA
PGDIFGAENGVPGEQGLQGLPGDRGFPGDSGLSGPKGLPGKLGLIGPKGERDSPGTXGHV
GQSDIPGTIGLLGIKGKPGLPGTPGFPGTSGHPGKRGPKGEAGSPASTRKRGLPGLKGLP
GTPGLIGFQGNSGLPGGTGLPGFPGPNGEKGSVGLIGFPGMPHLPGIPGANGLKGIPGLD
GNVGPSGWAGSPGQKGDRGDLGPVGIPSLRLPMLNLQFKGDKGCQGSAGLDGFPGCRGDK
GEAGLPGSPGLPGAPGFPSTIKGLNGRPGSPGSTGLRGLPSLKGSPGILGFPEIAGESGS
QGLSGAPGLPGTSGLPGLKGDQGQTFGLPGRPGPKGQPGEPGLHSMKGKSGQVGDMGFPG
IKGDDGKVGIPGDVGLPGSPGLPGIAGMRGNPGLSGSPGHSGPPGPVGPPGIIGTKGYPG
VFGLHGLNGLPGTKGTHGTPGPSITGVLGPAGLPGPKGEKGSPGIGTGVSGKPGMKVQKG
GQGFPGLQGPAGPPGAPGLSLPSVIARQSGDPGRPGLDGKRGCPGPPGPPGTPGPSSHQG
DPGDPGFPGIPGPKGPKGHPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGLPG
MKGKASPRGFSGPQGAPGQTPIAENIQTPPGPVDQPGIDGIPXGDHGVQGPIGLQGSKGL
PGIPGKDGPSGLPGPPGALGDPGPPRLQGPPGYEGPPGKQGPFGKAGLPGQSVRVGYTLV
KHSQLKQVPLCPSEMTQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPHFSTVPVIYCNSNE
AXKSYWLSPTAPLPMTPIGQTKIPQYISRCSVCEAPSQAIAVPIQDITIPQCPLGWCSLW
IGYSFLMHTAASAEGGGQSLVSPGSCLEDFCATPFIECSGARGTCCYFANKYSFWLTTME
EWQQFGEEPVAETLKARQPHTQVSRCQVCVKSI
NT seq 4962 nt   +upstreamnt  +downstreamnt
atgctgggtatcagggaaggtagagtggggcaaccaggacaaattggaattcaaggtcca
acaggtcctcaaggatttgctggccctagtggtttatcagggttaaaaggagaaaggggt
tcaccaggccctctgggactatatggaccaaaaagagataagggtcccatgggagttcct
ggctttcttggcattaatgggattctgggccaccctggacagccagggccctgaggccca
cgtggcctggatggctgtaatggaactcaaggagctgtcggatttccaggccctgatggc
tatcctggggttctcggaccacctggtcttcctggtcagaaaggatgtaaaggtgaacct
gtccttactgaaggtcatttcaaaggaatgaagggggatcctggactgcctggactagac
ggaatcactggcccacgaggaccacctggttctccagaagctgtagaacctataggatca
ccaagatttcaagtaagtcctccaggtcctcctggtctccctggtcttgatgggaatatg
gggctaggtttccaagaagacaaggtaaagggagatgttggcctccctggctctgcagga
cacccaccatctaccggagaactggaatttatgggatttcccaaagggaaaaaatgatct
aagggggaaccagggcttccaggtttcccaggaacaagtggccgtccaggtcgcccaggt
tttggaactgctgaagaaaaaggagaaaaaggaatccctggtttgccaggacctagggga
cccatgggtttaccaggagtccaaggacctccagggagtcagggcaagaaggggtcctca
ggtttccctggacttaatggattgccaggaattaagggtggaaagggtggcattggcctg
ccaggcccagatgttcacatcgatacaggtggtgctgtgatctcaggttatcctggagac
cccagtatcccagacatcccaggacttgaaggtgatgaaggtatccagggcctgcctggc
ttccctggtctccctggcttaccagctataccaggtgtgccaggtgccctagggccccag
gaagtcccaggcctgaaagggaacaaaggaaacccaggccacacaacaattggtgcagct
ggccttcctggaaaagatagtttgccaggcgtaccaggtttaccaggcccagctggtcca
gcatttgagcctggaactgtacagaacacagagccagggttctctggtctccaaggagaa
cggagtccaaaaggaaaccaaggtctcaaaggagtaaaaggagatttgggattttgtgct
tgtgatggctgttccctcccccacactggaccacctgggaaaccaggtcacataggcctt
ccaggccttaaaggagccagaggagatccaggttctggaggcacacagggcccatcaggg
tctccaggtttatttgggcctcaaggtcctacaggtcccaaaggagagaaaggggaatca
accctcagtataagatcaggaatgccaggggagcaggatgatcctggtttcccaggggtc
cctggtgagacaggagtaccaggcaagaacggaataccaggtttaccaggtctgccaggc
tttccgggtgatgttggacagggctttcctggtgaaaagggtttaccaggacttcctggt
gaaaaaagccttagtggtccacctggattcccaggaactgggctaccagggtctcctgga
ncttgtggacttcctggagaccaatgaatagatggatttccaggaaaacctggcattcct
gggcctgcaggtgactgctgctgcagggacaaagttggtaaaggagacttagacacagag
ggaggtatcaccttgccttgtattattcctgggccatacagtccttcaggattccctgga
gctcccggattctcaggccctaaaggggcccgtggcctccctgggactctaggccggcct
ggattttgtggaaataaaggagaacctggaagcccaggatcagttcagctcactacgttt
cagccaggatttcctggacctaatggggagaagggcttgcctgggtttcctggactccct
ggaaaagatggcttgcctgacaaagttggcaatccaagtttaccaggttctaaaggagcc
cctggtgacatctttggtgctgaaaatggtgttccgggggagcaaggcctacagggatta
ccaggggacagaggatttcctggagactctggcctttcaggacccaagggtttgcctggg
aagttgggcttgataggtcccaaaggagaacgggacagtcctggaacatgaggccatgtg
ggacagtcagacatcccagggactattggtttacttggcatcaagggaaaaccagggctg
ccaggaacaccaggctttccaggcacttcaggacatcctggaaagagaggtccaaagggt
gaggcaggttcccctgcatcaactagaaagagaggtctgcctgggctgaaaggccttcct
ggaactccagggttaattggcttccagggcaactcaggcttgccaggaggcactgggctt
ccaggatttccaggtccaaatggtgagaaggggtctgttggactgataggttttccaggg
atgccacatctccctggtattcctggtgcaaatggattgaagggaattcctgggttagat
ggaaatgtgggaccatctggatgggctggtagccctggtcaaaaaggagacagaggtgac
ctggggccagttggaattcccagtctaagacttccaatgcttaacctccagttcaaagga
gacaaaggctgtcagggctcagctggattggatggatttcctggatgcagaggtgacaaa
ggagaagctggcctccctgggtcaccaggcttacctggagctcctggattccccagtacc
atcaagggacttaatgggagacctggctcccctggctccacaggactacgaggcttaccc
agcctgaaaggctcccctggaatcttgggcttcccagaaattgcaggagaaagtggttca
cagggtctcagtggagctcctgggctcccaggaacatctggccttccaggtttaaaagga
gatcaaggccagacatttggacttcctggcagaccaggacctaagggacaacctggggaa
cctggcttgcatagtatgaaaggaaaatctggacaagttggtgacatgggtttcccagga
attaaaggtgacgatgggaaagttggtattcctggagatgttggccttcccggctcccca
ggactccctgggattgcaggcatgagaggaaatccagggctttcaggttctccaggccac
tcagggcctcctgggcctgtgggaccccctggtataataggaactaaaggttatcctgga
gtttttggtttgcatggactaaatggtcttccaggaaccaaggggacccatggaactcca
ggacctagtataactggtgtgctagggccagctggcttgcctggtcccaaaggggaaaaa
ggttctccaggaattggcactggagtgtcagggaagccaggcatgaaagtacaaaaaggt
ggccaaggttttccaggtctccagggccctgcaggtccccctggtgccccaggcctctct
ttgccctcagtcatagcaagacagtctggagaccctgggagacctggactagatggaaaa
cgaggctgtccagggcctccaggtcccccaggcacccctgggccatcctctcatcaaggt
gaccctggagaccctggcttccctggaattcctggccctaaagggcccaaaggacaccca
ggaattccaggtttctctggcctccctggagagctaggactgaaaggcatgagaggcgag
cctggcttcatggggactccaggcaaggttgggccacctggagacccaggattacctggg
atgaaggggaaggcaagtccaagaggcttttctggcccccaaggtgctcctggccaaaca
ccaattgcagaaaacattcagactcctcctggacccgtggatcaaccgggcattgatggc
atccctnngggagatcatggagttcaaggccctataggcctacaaggctccaaaggttta
cctggcatccctggcaaagatggcccaagtgggctccctggcccacctggggctcttggt
gaccccggtcctcctagactgcaaggccctccaggatatgagggacctccaggaaaacaa
ggcccgtttggcaaggctggattgcctggacagagtgtgagagtgggctacaccttggtg
aagcacagccagctgaaacaggtgcccctctgtccctccgagatgacccagctgtgggtc
ggttacagcttgctgtttgtggaggggcaggagaaagcccacaaccaggacttggggttt
gctggctcctgcctgccccacttcagcactgtgcccgtcatctactgcaacagcaatgaa
gccnnaaagtcctactggctctcccccactgcccccctccccatgacgcccatcggccag
accaagatcccccagtacatcagccgctgctctgtgtgtgaggcaccctcacaagccatt
gctgtgcccatccaggatatcaccattccacagtgccccctgggctggtgcagcctctgg
attgggtattccttcctcatgcacactgctgccagcgccgagggtggaggccagtccctg
gtctcacctggctcctgcctagaggatttttgtgccactcctttcattgagtgcagtggt
gcccggggcacctgctgctactttgccaacaagtatagtttctggctgacgacaatggaa
gagtggcagcagtttggggaggaacctgtagcagaaacattgaaagccaggcagccccac
acccaagtcagccgctgccaggtatgtgtgaaaagcatatag

KEGG   Desmodus rotundus (common vampire bat): 112297058
Entry
112297058         CDS       T05907                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112297058 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112297058 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112297058 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112297058 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112297058 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112297058 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112297058 (LAMA2)
   05414 Dilated cardiomyopathy
    112297058 (LAMA2)
   05416 Viral myocarditis
    112297058 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112297058 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112297058 (LAMA2)
   05145 Toxoplasmosis
    112297058 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 GHMP_kinases_C DUF948
Other DBs
NCBI-GeneID: 112297058
NCBI-ProteinID: XP_024407636
LinkDB
Position
Unknown
AA seq 3125 aa
MPGAAGVLLVLLLSGGLGGGQEHRLQQLPQAHQQRGLFPAVLNLASNALITTNATCGEKG
PEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIEYH
YVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQFHAVTDTECLTLYNI
YPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIR
LRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPPDPVT
SKSRCECEHNTCGDSCDRCCPGFHQKPWQAGTVLTKAECEACNCHGKAEECYYDENVARR
NLSLNIHGKYIGGGVCINCTHHTAGINCETCVDGFFRPKGVSPDNPRPCQPCHCGPVGSV
SEACIKDEKHARPGLAPGSCHCKPGFGGINCDRCVRGYTGYPDCRPCNCSGEGSTNEDPC
FGPCNCKENVEGGDCSRCKSGFFNLQADNHKGCDECFCSGVSNRCQSSYWTYGNIQDMSG
WYLTDISGHIRLAPQQGDWERPQQISIRSTEARRELPREYFWSAPAPYLGNKLTTVGGRL
KFTISYDLEGEEKEEGEEETEHVLQLIVILEGNDLRISTAPDEVYLKPSEKHMAELSLKE
DLFTRHGTHFPVSRKEFMTVLVDLKRVLLQITDSLGVDAIFRLSSVDLESAVPYPTEGSF
ATAVEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCRCFGHAEYCDDVTGECLNCE
DHTGGPYCNKCLPGFYGDPTKGTSEDCQPCACPLSTPSNNFSPTCHLDRSLGLICDECPV
GYTGPRCERCAEGYFGQPSVRGGSCQPCQCNDNLDFSIPGSCDSLSGACLICKPGTTGRY
CELCADGYFGDAVDAKNCQPCHCNANGSFSEICHTRTGQCECRPNVLGQRCDRCKPETFG
LQSSRGCVPCNCNSFGSKSFDCDDSGQCWCQPGVTGKKCDRCAQGHFNFQEGGCTACNCS
HVGSTCDPTTGQCICPPNTIGDQCSQCAPRTWGHSIVSGCKACNCSMVGSLDFQCNVNTG
QCTCHPKFSGAKCTECRRGHWNFPHCTPCDCFLPGTEEATCDSETKKCSCVDRTGQCTCK
VHVEGVHCDRCRSGKFGLDAKNPLGCSSCYCFGTTTQCSEAEGLIRTRVTLKPEQTILPL
VDEALQHTTTKGIDFQDPEIVANMDRVRQDLHLEPFYWKLPEQFEGKKLMAYGGKLKYTI
YFEAREETGFFTYNPQVIIRGGTPAHARVIIRHMAAPLIGQLTRHEIEMTEKEWKYYGDD
PRVSRTVTREDFLNVLFDIHYILIKATYGNVMRQSSISEISMEVAEQGRVTAVTPAARLI
EKCDCPPGYSGLSCETCMPGFYRLHSGPGSRTPGPTLGTCVPCQCNGHSSLCDPETSICQ
NCQHHTAGDFCERCAVGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVMEGLDDYRCTAC
PRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPHGSMPVPCDAVTGLCTCRPGATGPKC
DGCKHWHAREGTECVFCGDECTGILLGDLARLEQMATSINLTGPLPAPYKTLYGLENVTQ
ELKHLLSPQRAPERLIQLAEGNLNTLVMEMNELLTRATKVTADGEQTGQDAERTNTRADS
LGEFIKELVRDAEAVNEKAIKLNETLGIQDKDFERNLQGLQKEIDQMMSELRRKNLDAQK
EVAEDELVAAEGLLKKVQRQFGESRGKNEDLEKDLREKLTDYKSKLDDAWDLLREATDKI
REANHLSAANQKNMTALDKKKEAIESGRRQTENTLKEGKDILDEANRLADEINAGIDYVE
DIQTKLPPMSEELKDKIDDLSQEIKDRKLAERVSQAESHAAQLNDSSAVLDGILDEAKNI
SFNATAAFKAYTNIKEYIDEAEKIAKEAKGLTQEATKLATGPQGSLKEDAKGSLQKSFGV
LNEAKKLADNVKVNDDHLNGLKTRLEDADVRNGHLLGALNDTLGKLSAIPNDTAAKLQAV
KDKARQANDTAKDVLAQIKDLHQNLDGLKKNYNQLADSVAKTNALVKDPSKNKIIADADA
TVKNLEQEADRLINKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRT
YKPEIKKGSYNNIVVNVKTPVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRV
EYPDLAIDDSYWYRIEASRTGRNGTISVRALDGPKASIMPSTYHSVSPPGYTILDVDANA
MLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWNFREIEGDCKGCTVSPQVEDS
EGTIQFDGEGYAMVSRPIRWYPNISTVMFKFRTFSSSALLMYLATKDLKDFMSVELTDGH
IKVSYDLGSGMASVVSNRNHNDGKWKSFTLSRIQKQANISIIDIDTNQEENIATSSPGNN
FGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGV
TKGCSLENVYTVSFPKPGFVELAPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRK
RRQTGQAYYAIFLNKGRLEVHLSTGTRTMRKIVIKPEPSLFHDGREHSVHVERTRGIFTV
QVDEERRHMQNLTIEQVIEVKKLFVGGAPPEFQPSPLRNIPPFEGCVWNLVINSVPMDFA
RPVSFKNADIGRCAHQKPSEDGDGEVPAEIVIQPEPVPTPAFPAPTPGLAHGPCAAESEP
ALLIGSKQFGLSKNSHIAIAFDDTKVKNRLTIEFEVRTEAESGLLFYMARINHADFATVQ
LRNGFPYFSYDLGSGDTNTMIPIKINDGQWHKIKITRIKQEGILYVDDASNRTVSPKKAD
ILDVVGMLYVGGLPINYTTRRIGPVTYSVDGCIRNLQMAEAPADLEQPTSSFHVGTCFAN
AQKGTYFDGTGFAKTVDGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKI
MFHVDNGAGRFTAVYDAGVPGRLCDGQWHKVTANKIKHRLELTVDGNQVEAQSPNPASTS
ADTNDPVFVGGFPDDLHQFGLTTNIRFRGCIRSLRLTKGTGKPLEVNFAKALELRGVQPV
SCPAK
NT seq 9378 nt   +upstreamnt  +downstreamnt
atgccaggggccgcgggggtccttctggtcctgctgctcagcgggggcctcgggggcggc
caggagcaccggctgcagcagctgccacaggcgcatcagcaaagaggtttattccctgct
gtcttgaatcttgcttctaatgccctcatcactacaaatgcaacatgtggagaaaaggga
cctgaaatgtattgtaaactggtggagcatgtgcctgggcagcctgtgaggaacccccaa
tgtcgaatctgcaatcaaaacagcagcaatccaaatcagagacacccaattacaaatgct
attgatgggaagaacacttggtggcagagtcccagtattaagaatggaattgaataccat
tatgtgaccattacactggatttacagcaggtgttccagatcgcgtatgtgattgtgaaa
gcagctaactcccctcggcctggaaactggatcctggaacgctcactggatgatgttgaa
tacaagccctggcagttccacgctgtgacggacaccgagtgcctaaccctctacaacatt
tacccccgcactggaccaccatcatatgccaaagacgatgaggtcatctgcacctcgttt
tactccaagatacaccctttagagaatggagagattcacatctccttgatcaatgggaga
ccgagtgcagatgatccttctcctgaactgctagaatttacctctgctcgctatatccgc
ctgagatttcagaggatccgcaccctgaatgccgatttgatgatgtttgctcacaaagac
cccagagaaattgatcccattgtcacacgaaggtactactactcggtcaaggacatctcg
gtcggagggatgtgcatctgctacggtcatgccagggcttgtccgcctgatccagtgaca
agtaaatcccgctgcgagtgtgaacacaacacgtgcggtgacagctgtgaccggtgctgc
ccaggcttccaccagaagccgtggcaagctggcaccgtcctgactaaagccgaatgcgaa
gcatgcaactgtcatgggaaagctgaagaatgctattacgatgaaaatgtggccagaaga
aatctgagcttaaacatacacggcaaatacattggagggggtgtgtgcatcaattgtacc
caccacaccgctggtataaactgtgagacatgtgtggatggtttcttcagacccaaaggg
gtatctccagataacccaaggccatgccagccgtgccactgtggcccagttggttccgtc
agtgaagcctgcatcaaggatgaaaagcatgctcggccaggtctggcacccgggtcctgt
cattgcaaacctggctttggaggcataaactgtgatcggtgtgtccggggctacactggc
tacccagactgcagaccctgtaactgcagtggtgaaggaagcacaaacgaggacccttgt
tttggaccctgtaactgcaaggagaacgttgaaggaggagactgcagccgctgcaaatct
ggcttcttcaacttgcaagcagataaccataaaggatgtgacgagtgtttctgttctggg
gtttccaacagatgtcaaagctcctactggacctatggcaatatacaagacatgagtggc
tggtatctgacggacatctccggtcacatccggttggcgccccagcagggtgactgggag
cgcccccagcagatcagcatccgcagcacagaggcccgcagagagctgcctcgggagtac
ttctggagtgcaccagctccctatctgggaaacaagctcaccacagttggaggacgatta
aaatttaccatatcatatgaccttgaaggagaagaaaaagaagaaggagaagaagaaaca
gaacacgtactccagcttatagttattttagagggaaatgacttgagaatcagtacagcc
cccgatgaggtgtacctgaaaccatctgaaaagcatatggctgaattgtcactcaaagaa
gatttattcaccaggcacggcacgcattttccagtcagtaggaaagagttcatgacagtc
cttgtggatttaaagagagtcctcctccaaatcacagacagccttggggtggatgccatc
ttcaggctgagctccgttgaccttgaatctgcggtgccctatcccactgaggggagcttt
gcaacagctgtggaagtctgccaatgcccaccagggtacactggatcctcctgtgaatct
tgctggcctaggcacagacgagtgaatggcactatttttggtggcatctgtgaaccttgt
cgatgctttggccacgcggagtactgtgacgacgttaccggagaatgcctgaactgtgag
gatcacacaggtggcccatactgcaataaatgtcttcctggtttctatggcgatcctact
aaaggaacctcggaagactgtcagccctgtgcctgtccactcagtaccccatcaaataac
tttagcccgacgtgccatttagaccgaagtcttggattgatctgtgatgaatgccctgtc
gggtacacaggaccacgctgcgagaggtgtgcagaaggctattttggacaaccttctgta
cgcggaggatcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggc
agctgtgacagcttgtctggcgcctgtctgatatgtaagccaggtacaacaggccggtac
tgtgagctctgtgctgatggatattttggagacgcagttgatgcaaagaactgtcaacct
tgtcactgtaatgccaatggctccttctctgagatttgccacactaggacaggacagtgc
gaatgcagacctaacgtgctgggccagcggtgtgacagatgtaagcctgaaacctttggc
ctacagtcgtcaagagggtgtgtcccctgcaactgtaattcctttgggtctaagtcgttc
gactgtgacgacagtggtcagtgttggtgccagcctggagtgacaggaaagaaatgtgac
cgatgcgcccagggccatttcaacttccaagaaggaggatgcacagcttgtaactgttct
catgtgggtagtacgtgtgacccaacgactgggcaatgcatttgccctcccaataccatt
ggagatcagtgttcccaatgtgcacctaggacctggggccacagcatcgtctccgggtgt
aaggcttgcaactgtagcatggtgggatccttggatttccagtgcaacgtaaacacgggc
cagtgcacctgtcatccaaaattctctggtgcaaagtgtacagagtgcaggcgtggtcac
tggaacttcccgcactgcactccctgtgactgcttcctgcccgggactgaggaggcgacc
tgtgattctgagaccaaaaaatgctcctgcgtggatcgaacggggcaatgcacttgcaag
gtgcatgtggaaggtgtccactgtgacaggtgccggtctggcaaattcggacttgatgcc
aagaacccacttggatgcagcagctgctattgctttggcaccactactcagtgctctgaa
gcggaaggactgatccgcacgagggtgactctgaagcctgagcagaccattctgcccctg
gtggatgaggccctgcagcacacaactaccaaaggcattgattttcaagatccagagatt
gttgccaacatggatcgggtgagacaagatctccatttggaacctttttattggaaactt
ccagagcaatttgaaggaaagaagttgatggcctatggcggaaaactcaagtatactatc
tattttgaggcaagagaagagacaggtttctttacatataatcctcaagttatcattcga
ggtgggactccagctcatgctagggttatcatcaggcatatggctgctcctctaattggc
caactgacaaggcatgaaatcgaaatgacagagaaagagtggaaatattatggtgatgat
cctcgagtcagtagaactgtgacccgtgaagacttcttgaatgtactctttgatatccat
tatattcttatcaaggctacatatggaaatgtgatgagacaaagcagcatttctgaaatc
tcaatggaggtcgctgaacaaggacgggtaacagcagtgactcctgcagctcgcttgatc
gaaaaatgtgattgtcctccgggctactctggtttgtcctgtgagacatgcatgccagga
ttttatcgactacattctgggccgggcagccgcacccctgggccaactctgggcacctgt
gttccatgccagtgtaatggacacagcagcctctgtgaccctgaaacctccatatgccag
aattgccagcaccacactgctggtgacttctgtgaacgatgtgctgtcgggtactacgga
attgtcaagggattgccaaatgactgtcagcagtgtgcttgccctctgatttcttccagc
aacaatttcagcccttcttgtgtcatggaaggcctggacgattaccgctgcacggcttgt
ccacgcggatacgaaggccagtactgtgaacggtgtgcccctggctatactggcagccca
agcagtcccggaggctcctgccaagaatgtgagtgtgacccccatggctcaatgcctgtc
ccgtgtgatgctgtcacagggctctgcacgtgccgacctggagccacggggccgaagtgt
gatggctgcaagcactggcatgcacgagagggcacggagtgtgttttctgcggagatgaa
tgcacaggcattctgctgggtgacctggcccgcctggagcaaatggccacgagcatcaac
ctcacgggccccctgccggctccgtataagacgctgtacggccttgaaaacgtgacgcag
gaactaaagcacttgctgtcacctcagcgggccccagagaggctcattcagttggcagag
ggcaatctgaacacactcgtgatggaaatgaatgagcttctgaccagggctaccaaagtg
acagcagatggcgagcagactggacaggatgctgaaaggaccaacacaagagcagactcc
ttaggagaattcattaaggaacttgtccgggatgcagaagctgtaaatgaaaaagccata
aaactaaatgaaactctaggaattcaagacaaggactttgagagaaatttgcaagggctt
cagaaagagattgatcagatgatgagcgaattgcggaggaaaaatctagatgcacagaaa
gaagttgctgaggatgagttggtagcggcggagggcctgctgaagaaagtgcagaggcag
tttggagagtcgcgagggaagaacgaggacctggagaaggatctccgggagaaattgaca
gactacaagagcaagctcgatgatgcttgggacctgttgagagaagccacggataaaatc
agagaagctaatcacttatctgcagcaaaccagaaaaacatgactgctctggacaaaaag
aaagaggcgattgaaagtggcagacgacaaactgagaacactttaaaagaaggcaaagac
atacttgatgaggccaaccgtcttgcagatgaaatcaacgcaggcatagactatgttgaa
gacattcaaactaaattaccacccatgtccgaggagctgaaagataaaatagatgacctc
tcccaagaaataaaagacaggaagcttgctgagagggtgtcccaggctgagagccatgcc
gctcagttaaatgactcatctgctgtccttgatggaatccttgatgaggctaaaaacatc
tccttcaatgccacggcagccttcaaagcttacaccaatattaaggaatatattgatgaa
gctgagaaaattgccaaagaagccaaaggtcttacacaagaagctacaaaactggcaacg
ggtcctcagggttcattaaaggaagatgccaaaggttctcttcagaaaagctttggggtt
cttaatgaagccaagaaattagcagataatgtaaaagtaaatgatgaccatttgaatggc
ttgaaaaccagattagaagatgccgatgttagaaatgggcatctcctgggagccctgaat
gacactctggggaagttatcagccattccaaatgacacagcagctaaactgcaagctgtt
aaggacaaagcaagacaagcgaatgacacagcaaaagatgtactggcacagattaaagat
ctccaccagaacctcgatggcctgaagaaaaattataatcaactagcagacagcgtagct
aaaacaaatgctctggtgaaagatccttcaaaaaacaaaatcattgcagatgcagatgcc
accgtgaaaaatctagagcaagaagctgaccgactgatcaataaactcaaacccatcaag
gaactagaggataacctgaagaaaaacatctctgagatcaaggaactgataaaccaagcc
cggaaacaagccaattctatcaaagtatctgtgtcttcgggaggtgactgcattcgaacg
tacaagccagaaatcaagaaaggaagctacaataatatcgttgtcaatgtgaagacacct
gttgctgacaacctccttttttatcttggaagtgccaaatttattgactttctggctata
gaaatgcgtaaaggcaaagtaagcttcctctgggatgttggatctggagttggacgtgta
gagtatccagatttggctattgatgactcatattggtaccgtattgaggcatcaagaact
gggagaaatggaaccatttctgtgagggccctggatggacccaaagccagcattatgccc
agtacataccattcagtgtctcctccagggtacacaattctagatgtggatgcaaatgca
atgctcttcgttggcggcttgactgggaagttgaagaaggctgatgctgtgcgtgtgatc
acattcactggctgcatgggagagacgtactttgacagcaaacctatagggttgtggaat
ttccgagaaatagaaggtgactgcaaaggatgtaccgtcagtcctcaggtggaagatagt
gaggggacaattcagtttgatggagaaggctatgcaatggtcagccgccccattcgctgg
taccccaacatctccacagtcatgttcaagttcagaacattttcctcaagtgctctcctg
atgtaccttgccacaaaagacctgaaagatttcatgagtgtagagctcactgatgggcac
ataaaagtcagctatgatctgggttcaggaatggcttctgttgtcagcaatcgaaaccat
aatgacgggaaatggaaatcattcaccctctcaagaattcaaaaacaagccaacatatca
attatcgatatagatactaaccaggaggagaacatagcaacctcatctcctggaaataat
tttggtcttgacttgaaagcagatgacaaaatatattttggtggtctgccaacactgaga
aacttgagtatgaaagcaaggccggaagtaaatttgaagaaatattctggctgcctcaaa
gatattgaaatttcaagaacaccatataatatactcagtagccctgactatgtgggcgtt
accaaaggatgttcgctggagaatgtttacacagttagcttccccaagcctggctttgtg
gagttggcccctgtaccaattgatgtagggacagaaatcaacctgtccttcagcaccaag
aacgagtctgggatcattctcttgggaagtggagggaccccagcaccacctcggaggaaa
cgaaggcagactggacaggcctattatgcgatattcctgaacaagggccgtctggaagta
catctctccacaggcacacgaacaatgaggaaaattgtcatcaaaccagagccgagtctg
tttcacgacgggagagaacattccgttcatgtggagagaactagaggcatctttactgtt
caagttgatgaagaaagaaggcatatgcaaaacctgacaatagaacaggtgattgaagtg
aaaaagctttttgttggcggtgcaccacctgagtttcaaccttccccgctcaggaatatt
cctccctttgaaggctgtgtatggaaccttgttattaactccgtgcccatggactttgca
cggcctgtatccttcaaaaatgcagacattggtcgttgtgcccatcagaaacccagtgag
gatggagatggagaagttccagctgaaatagttatccagccggagccagttcctacccca
gccttcccagcgcccaccccaggcctggcacatggtccttgtgctgcagaatcagaacca
gctcttttgatagggagcaagcagtttgggctctcaaaaaacagtcacattgcgattgca
tttgatgacaccaaagtgaaaaaccgcctcacaattgaatttgaagtacgaaccgaagcc
gaatcaggcttgcttttctacatggctcggatcaatcatgccgactttgctacggttcag
ctgagaaacggatttccctacttcagttacgacttaggaagtggtgacaccaacaccatg
atccccatcaaaatcaatgatggccagtggcacaagattaagattactcgaattaagcaa
gaaggaattctttatgtagatgatgcctccaacagaaccgtcagtcccaagaaagctgat
atcctggatgttgtggggatgttgtacgttggtgggctacccatcaactacactacccga
agaatcggtccagtgacctacagcgttgatggctgcatcaggaatctccagatggcagag
gcccctgctgatcttgaacagccaacctccagcttccatgttgggacatgttttgcaaat
gctcagaaaggaacatattttgatggaacgggttttgccaaaacagttgatggcttcaaa
gtggggttggaccttcttgtagaatttgaattccgaacaactagaaccacaggagttctc
ctgggaatcagcagccaaaaaatggatggaatgggtattgaaatgatcgatgaaaagatt
atgtttcatgtggacaatggcgctggccgattcactgctgtctatgatgctggggtccca
gggcgtctgtgtgatggacaatggcacaaagtcacggccaacaagatcaaacaccgcctt
gagctgacagtagatgggaaccaggtggaagcccagagcccaaacccagcatctacatca
gcagatacaaatgaccctgtgtttgttggaggtttcccagatgacctgcaccagtttggc
ctgacgaccaacattcggttcagaggttgtatccggtccctgaggctcaccaaaggcacg
ggcaagcccctggaagttaatttcgctaaggccctggagctcaggggcgttcaacctgta
tcatgcccagctaaataa

KEGG   Desmodus rotundus (common vampire bat): 112297463
Entry
112297463         CDS       T05907                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112297463 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112297463 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112297463 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112297463 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112297463 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112297463 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112297463 (LAMB3)
   05145 Toxoplasmosis
    112297463 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II F5_F8_type_C ATG16 BNR_6 IpgD
Other DBs
NCBI-GeneID: 112297463
NCBI-ProteinID: XP_024408024
LinkDB
Position
Unknown
AA seq 1172 aa
MRPLLLLWFAFPSLLHAQQACSHGACYPPAGDLLIGRTQFLRASSTCGLTRPETYCTQYG
EWQMKCCKCDSRLRHNYNSHRVENVVSSSGATRWWQSQNDVNPVSLQLDLDRRFQLRDIT
VDFKGRMPAGMLIERSSDFGKTWHVYQYLAADCTSAFPRVRQGQPQSWQDARCRSLPQRT
NAHQDGGKVQINLMDLASRIPATQSQKIQELGEITNLRINFTRLAPIPQRGRLPPSAYYA
VSQLRLQGSCFCHGHADRCAPDPGAPAGPSTTVKVHDVCVCQHNTAGPNCERCAPFYNNR
PWRPAEDQNPHECQRCDCNGHSETCHFDPAVFANSQGAHGGVCDNCRDHTEGRNCERCQL
HYFRNRRPGAPIEETCIPCECDPDGAVPGVPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
THANPQGCHRCDCSVLGSRRDMPCDEETGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPNNSLSPHCNQFTGQCPCREGSGGLTCSAAAIRQCPDQTYGDAAAGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTRPRCDQCQRGYCDRYPVCVACHPCFQTYDADLQEHALRLN
SLLNATASLRLRPGLEDPGLASRMLDAKSKIAQIQAILGGTPATEREVAQLASAIFSLRR
TLQDLQRPLPLEEEALTLPGDLESLDRSFNRLLIMYQNKREQYEKIGSADPSGAFQMLTT
AYQRSSQAAQQVSNSVHQLVQVRDIRRDAERLEKQVGGGGGASGPQLAALKLEMASLPDL
TPTINKLCGGSRQTACTPGACLGELCPRDNGTACGFHCKGALPRAGEAFRTAGQVADQLR
AFNTQLQQTRQMIRAAEEAASQVQSDAQRLETQVSTSRSQMEEDVRRTRLLIQQVRDFLS
DPDTNAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPHVDLVLAETKQDVARAR
RLQAEAEQARSRAHAVEGQVEDVVGNLQQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQ
VLGPAQRLVTGMMEQLGDFRARMEELRRQAQQEQAQAAQAQQLAEGASEGALSAQEGFER
VKQKYAKLKNRLSQSPTLGEQGSRILSIKTEAEELFGETMEMMDRMRDMESELLQGSQAI
ILRSADLTGLEKHVEQIRDHINERVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaggccactccttctcctgtggtttgcctttcccagcctcctgcatgcccagcaagcc
tgttcccatggggcctgctatccccctgctggggacctgctcattgggaggacccagttt
ctccgagcttcatctacctgtggactgaccaggcctgagacctactgcacccagtatggc
gagtggcagatgaaatgctgcaagtgcgactccaggttgcgtcacaattacaacagtcac
cgagtggagaatgtggtttcgtcttccggcgccacgcgctggtggcagtcacagaacgat
gtgaaccctgtctctctgcagctggatttggacaggagattccagcttcgagacatcaca
gtggactttaagggccgcatgcctgccgggatgctgatcgagcgctcctcggactttggt
aagacctggcacgtgtaccagtatctggctgctgactgcacgtctgcctttccccgcgtc
cgccagggccagcctcagagctggcaggatgctcggtgccggtctctgccccagaggact
aatgcgcaccaagatgggggcaaggttcagattaaccttatggatttagcctctaggatt
ccagcaactcaaagtcaaaaaattcaagagctgggagagatcacaaacttgagaatcaac
ttcaccaggctggcccctataccacagaggggccgccttccccccagtgcctactacgca
gtgtcccagctgcgtctgcaagggagctgcttctgccatggccacgctgaccgctgcgcc
cccgatcccggagcccctgcaggcccctccaccactgtgaaggtccatgacgtctgcgtc
tgccagcacaacaccgccggccccaactgcgaacgctgtgcacccttctacaacaatcgg
ccctggagacctgcggaggaccagaacccacacgagtgccaaagatgtgactgcaacggt
cactcagagacctgtcacttcgacccagctgtgttcgccaacagccagggggcccacgga
ggggtgtgtgacaactgccgggaccacaccgagggcaggaactgtgagcggtgtcagctg
cactatttccggaaccggcgccctggtgctcccattgaggagacctgtatcccctgcgag
tgtgacccggatggggcagtgccgggggttccctgcgacccagtaaccgggcagtgcgtg
tgcaaggagcacgtgcaaggggagcgctgtgacctgtgcaagccgggatttacaggactc
acccacgccaacccgcagggctgccaccgctgtgactgcagtgtcctggggtcccggcgg
gacatgccctgtgatgaggagactggccgttgcctgtgtctgcccaacgtggtgggcccc
aaatgtgaccagtgcgctccctaccactggaagctggccagtggccagggctgcgagcca
tgtgcctgcgacccaaacaactccctcagcccccactgcaaccagttcacaggacagtgc
ccctgtcgggaagggtctgggggcctgacatgcagcgctgccgccatccgccagtgtcct
gaccagacctacggagacgcagccgcgggatgccgagcctgtgactgtgacttccgggga
accgagggcccaggctgtgacaaggcctcaggtcgctgcctctgccgccctggcttgacc
aggccgcgctgtgaccagtgccagcgaggctactgtgaccgctatcccgtgtgtgtggcc
tgccatccttgcttccagacctatgacgctgacctccaggagcacgccctacgcctcaac
agcctcctcaatgccactgccagcctgaggctccgtccaggcctggaggaccctggcctg
gcctcccggatgctggatgcgaagagcaagattgcgcagatccaggccattctcggcggc
accccggccacggagcgggaggtggcccagctggccagtgccatcttctctctcaggcgg
accctccaggacctgcagcgccctctgcccctagaagaggaggccttgaccctcccagga
gacctggagagcctggacagaagcttcaatcgcctcctcattatgtatcagaataagagg
gagcagtatgaaaagatcggcagcgcggacccttcaggagccttccagatgctgaccaca
gcttaccagcggtcatcccaggctgcccagcaggtctccaacagtgtccaccagctggtc
caagtcagggacatccggagagatgcagagaggctggagaagcaggtgggaggcggagga
ggagccagcggcccccagctggcagccctgaagctggagatggcttccttgcctgatctg
acacccaccatcaacaagctctgtgggggctccaggcagacagcctgcaccccaggagca
tgccttggggagctctgtccccgagacaacggcacagcctgtggcttccactgcaaaggc
gccctccccagggctggcgaggccttccggacagcgggacaggtagccgaccagctacgg
gccttcaacacccagctccagcagaccagacagatgatcagggcagccgaggaagctgcc
tcgcaggtgcaatccgatgctcagcgcctggagacccaggtgagcaccagccgctcccag
atggaggaagacgtcaggcgcacacggctccttatccagcaggtccgggacttcctctca
gatcctgacaccaatgcagccaccatccaggaggtcagcgaggctgtgctggccctgtgg
ctgcccacagactctgctacagtcctgcagaagatgaacgagatccaggccatcgcagcc
aggctcccccacgtggacctggtgttggcagagaccaagcaggatgtggcccgagctcgc
agactccaggctgaggcggagcaggccaggagccgagcccatgcagtggagggccaagtg
gaggatgtggtggggaacctgcagcagggcaccgtggcgctgcaggaggctcaggacacc
atgcaaggcaccagccgctcccttcggctcattcaggacagggttgctgaggttcagcag
gtgctggggccggcgcagagactggtgacaggcatgatggagcagctgggtgacttccga
gcacggatggaggagctacgccgccaggcccagcaggagcaggcgcaggcagcccaggct
caacagcttgcagaaggcgccagcgagggggcactgagtgcccaggagggatttgagaga
gtaaagcaaaaatacgccaagctgaagaaccggttgagccagagccccacgctgggggag
cagggcagccggatcctgagcatcaagacagaggcagaggagctgtttggagagaccatg
gagatgatggacaggatgagagacatggagtcagagctgctgcaggggagccaggccatc
attcttcgctcagcggacctgacagggctggagaagcacgtggagcagatccgtgaccac
atcaacgagcgggtgctctactacgccacctgcaagtga

KEGG   Desmodus rotundus (common vampire bat): 112297926
Entry
112297926         CDS       T05907                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05020  Prion disease
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112297926 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112297926 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112297926 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112297926 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112297926 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    112297926 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112297926 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112297926 (LAMC1)
   05145 Toxoplasmosis
    112297926 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 112297926
NCBI-ProteinID: XP_024408601
LinkDB
Position
Unknown
AA seq 1573 aa
MDECMDEGGRPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQ
PHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSR
PESFAIYKRTREDGPWIPYQYYSGSCQNTYVKANRGFIRTGEDEQQALCTDEFSDISPLT
GGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYA
ISDFAVGGRCKCNGHASECVKNEFDKLVCSCKHNTYGVDCEKCLPFFNDRPWRRATAESA
SECLPCNCNGRAQECYFDPELYRSTGHGGHCTNCQDNTDGPNCERCRENFFRLGSTEACS
PCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCACDPSGSTDEC
NIETGRCVCKDNVEGFNCERCKPGFFNLEPSNPRGCTPCFCFGHSSVCTNAVGYSVYPIT
STFQIDEDGWRAEQRDGSDASLDWSSERQDIAVISDSYFPRYFIAPAKFLGKQVFSYGQN
LSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEAADYPWR
PTLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARPGPGVPATWVETCTCPVGY
GGQFCESCLPGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVCHCRDNTAGPHCEKCSD
GYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPL
GRHGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIHNTAGFYCDRCQDGFFGNPRAPN
PADKCRACNCNPYGTTRQQGTCSPVTGQCECLPHVTGRDCGECDPGFYHLHSGKGCERCD
CHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCK
DNGRCECREGFVGSRCDQCEESYFYNRSWPGCQECPACYRLVKDKVADHRVKLQELEDLV
ANLGAGGEVVTDQAFEDRLKEAEKEVTALLREAQDAKDVDQNLLDRLQRVNSTLSSQIGR
LQNIRNTIEETGNLAEQARARVESTEQLIEIASRELEKAKVAVANVSITQPESTGDPNNM
TLLAEEARKLAERHKQEADDIVRVANTASDTSTEAYNLLLRTLAGENQTALEIEELNRKY
EQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVSQLTPVDSEALENEANKIKKEAEDL
DRLVDQKLKDYEDLRDDMREKEYEVKKLLESGKVEQQTADQLLARADAAKALAEEAAKKG
RNTLQEANDILNNLKDFDRRVNDNKTAAEEALKRIPAINQTIVEANEKTREAQLALGNAA
ADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVTNMLKQLQEAEKELK
RKQEDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLNLVNDLLEQLGQLDTVDLNKLN
EIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIMDYNRDIEEILKDIHNLEDIRKTL
PSGCFNTPSIEKP
NT seq 4722 nt   +upstreamnt  +downstreamnt
atggacgagtgcatggacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaac
gccgccttcaacgtgaccgtggtggccaccaacacgtgcggaactccgcccgaggagtac
tgtgtgcagaccggggtgaccggagtcaccaagtcctgtcacctgtgcgacgccgggcag
ccccacctgcagcacggggcagccttcctgaccgactacaacaaccaggccgacaccacc
tggtggcaaagccagaccatgctggccggggtgcagtaccccaactccatcaacctcacg
ctgcacctgggaaaagctttcgatatcacatacgtgcgcctcaagttccacaccagccgg
ccggagagcttcgccatttacaagcgcacgcgggaggacgggccctggatcccctaccag
tactacagtggctcctgccagaacacctacgtcaaggccaaccgcggcttcatcaggaca
ggggaggacgagcagcaggccttgtgcacagacgagttcagtgacatttcccctctcacc
gggggcaatgtggccttctctaccctggaaggaagacccagcgcctacaacttcgacaac
agccccgtgctgcaggaatgggtaacagccactgacatcagagtaactctcaatcgcctg
aacacctttggagatgaagtgtttaacgaccccaaagttctcaagtcctattattacgca
atctctgattttgccgtaggtggtaggtgcaaatgtaacggacacgccagcgagtgtgtg
aagaatgagttcgacaagctggtgtgcagttgcaaacataacacatacggggtggactgt
gagaagtgccttcctttcttcaacgaccggccgtggaggagggcgacggccgagagcgcc
agcgagtgcctgccctgcaactgcaatggccgagcgcaagaatgctactttgaccctgaa
ctctatcgttccactggccatggtggtcactgcaccaactgccaggataacacggacggc
cccaactgtgagaggtgccgggagaatttcttccgcctcgggagcacagaagcctgctct
ccgtgccactgcagtccggtcggttctcttagcacgcagtgtgacagctacggccgatgt
agctgtaagcccggagtgatgggtgacaagtgtgaccgttgccagcctggattccattct
ctcaccgaggcaggatgcaggccgtgcgcgtgtgacccttccggcagcacggatgaatgt
aacatcgaaaccggaaggtgtgtgtgcaaagacaacgtcgaaggcttcaactgtgagaga
tgcaaacctggattttttaatctggaaccatcgaatcccagggggtgcacaccgtgcttt
tgctttgggcattcttctgtctgcacaaatgccgtcggctacagtgtctaccctataacc
tctacctttcagattgatgaggacgggtggcgtgcagagcaaagggacggctctgatgcg
tcactggactggtcctccgagaggcaagacatcgccgtcatctcagacagctactttcct
aggtacttcatcgctcctgccaagttcttgggcaagcaggtgttcagttacgggcagaac
ctctccttctcctttcgagtggacaggcgagacactcgcctctctgcagaagacctggtg
ctcgagggggcaggcctgagagtgtccgtgcccttgatcgcgcagggcaactcctaccca
agcgagaccactgtgaaatacgtcttccggctccatgaagcagcagattacccttggagg
cctactcttactcctttcgagtttcagaagctccttaacaacttgacctccatcaagatc
cgtgggacatacagtgaaagaagtgctggatatttggatgatgtcaccctggcaagtgct
cgtcctggacctggagtccccgcaacctgggtggagacctgcacctgccctgtgggatac
ggagggcagttttgtgagtcgtgcctcccaggttacagaagagaaaccccaagtctcggg
ccgtacagtccgtgtgtgctttgtacctgcaacggacacagtgagacctgcgaccctgag
acgggtgtttgtcactgcagagacaatacagccggtccccactgcgagaagtgcagtgac
ggctactacggagattccaccgcgggcacctcctccgattgccagccctgtccgtgtcct
gggggctccagctgtgctgttgtccctaagactcaggaggtggtgtgcacaaactgcccc
actggcaccaccggtaaaaggtgcgagctctgcgacgacggctacttcggagacccactg
gggagacacggccccgtgcggctgtgccgcctgtgccagtgcaacgacaacatcgacccc
aacgcggtcgggaactgcaaccgcttgacgggagagtgcctcaagtgcatccacaacact
gccggcttctactgcgaccgctgccaggatggctttttcgggaacccgcgggctcccaac
ccagcagacaaatgcagagcctgcaactgcaatccctacgggaccacgcggcagcagggc
acctgcagccctgtgaccgggcagtgcgagtgtctgcctcacgtcaccggccgggactgt
ggcgagtgcgaccctgggttctaccacctgcacagcgggaaaggctgtgagaggtgcgac
tgccatgctttgggctccaccaacggacagtgtgacatccgcactggccagtgtgagtgc
cagcctggcatcaccggtcagcactgcgagcgctgcgaggtcaaccactttgggttcgga
cccgaaggctgcaaaccctgtgactgtcaccctgagggctccctgtcacttcagtgcaaa
gacaacggccgctgcgaatgtcgggaaggctttgtgggaagtcgctgtgaccagtgtgaa
gagagctatttctacaaccggtcttggcctggctgccaggaatgcccagcgtgttaccgg
ctggtaaaggataaggttgctgatcaccgggtgaaactgcaggaactagaggatctcgta
gcgaacctcggagctgggggtgaggtggtgactgatcaggcctttgaggatcgactgaag
gaagcggagaaggaggtgacggcgctccttcgcgaggctcaggatgccaaagatgtcgac
caaaacttgttggaccgcctccagcgagtgaactccaccttgtccagccaaatcggccgt
ttacagaacatccggaataccatcgaagagactggaaacttggctgaacaagcacgtgcc
cgggtagagagcaccgagcagttgattgaaatcgcgtccagggaacttgagaaagccaag
gttgccgttgccaatgtgtcaatcactcagccagagtccacgggagacccaaacaacatg
acccttttggcagaagaggcacgaaagcttgctgagcgccacaagcaagaagctgacgac
attgtacgagtggcaaacacagccagtgatacatcaactgaggcgtataatctgcttttg
aggaccctggcgggagaaaatcaaacagcgctggagattgaagagcttaatagaaagtac
gaacaggcgaagaacatctcgcaggatctagaaaagcaagccgcccgggtgcacgaggag
gccaagagggctggtgacaaagcggtggagatctacgccagcgtgtcccagctgaccccc
gtggactcggaggccctggagaacgaggcaaataagataaagaaggaagctgaggatctg
gaccgtctggttgaccagaagttgaaagattatgaggacctcagagacgacatgagagag
aaggaatatgaagtaaagaaacttctggagagcggaaaggtggaacagcagactgctgac
cagctcctcgcccgagctgacgctgccaaggctcttgcagaagaagctgccaaaaaggga
aggaacaccttacaagaagccaatgacattctcaacaacctgaaagacttcgataggcga
gtgaatgataataagactgctgcggaggaagcactgaagagaatccctgccatcaaccag
accatagttgaagccaatgaaaagacgagggaggcgcagctggccctgggcaatgcggcc
gcagatgccaccgaggcgaagaacaaggcccacgaggcggagaggatcgccagcgccgtc
cagaagaacgctaccagcaccaaggcagaagctgagaggacttttgcagaagtcaccgac
ctggacaacgaggtgaccaatatgctgaagcagctccaggaagcagaaaaggagctgaag
cgaaaacaagaagatgctgaccaggatatgatgatggcagggatggcctctcaggctgct
caggaagccgagatcaatgccaggaaggccaagaactccgttaccagcctcctcaacctt
gttaatgacctcttggagcagctggggcagctggacacagtggacttgaacaagctcaat
gagatcgaaggcaccctgaacaaagccaaagacgaaatgaaagtcagtgatctagacagg
aaggtgtctgacctggagaacgaagccaggaagcaggaagctgccatcatggactacaac
agagatatcgaggagatcttgaaggacatccacaacctggaggacatcagaaagaccttg
ccgtccggctgcttcaacaccccgtccatcgagaagccctag

KEGG   Desmodus rotundus (common vampire bat): 112302299
Entry
112302299         CDS       T05907                                 

Gene name
LAMB4
Definition
(RefSeq) laminin subunit beta-4
  KO
K06245  laminin, beta 4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112302299 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112302299 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112302299 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112302299 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112302299 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112302299 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112302299 (LAMB4)
   05145 Toxoplasmosis
    112302299 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 112302299
NCBI-ProteinID: XP_024413713
LinkDB
Position
Unknown
AA seq 1745 aa
MQFQLTFLLHLGLLSYAKAEDGCNNRACYPTTGNLLVGRSTQLTASSTCGLDGAQKYCIL
SYLEGEQKCFICDSRFPYDPHTQPNSHTIENVITNFEPDREKKWWQSENGLHHVSIRLDL
EALFQFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNIASGQAQGVGD
LVCDSRYSDVEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LRRMQNDSLDKYYYAVYEMVVRGSCFCNGHASECGLTQTVRGDVFAPAGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAAGLQDSSCRACSCNSHSDRCHFDMTVYLASGGVSGGVCE
DCRHNTEGQHCHRCRPLFYRDPLKAISDPYACLPCECDPDGTASGGICVSHSDPALGSVA
GQCLCKENVVGAKCDQCKPNHYGLSAADPVGCQPCNCNPLGSLPLSTCDVDTGQCLCQPS
ATGPHCEECVVGYWGLENHLHGCVPCDCDIGGAYSNVCSPEDGQCECRPHVAGRSCTEPA
PGYFFVSLNFYIYEAEEALPLQGLAPLGSATFGQVPAVHIVFREPVPGTPVTWTGPGFAR
VLPGSGLRFAVHNIPSPMNFTVAIRYETQSAADWAVQVAVNPPGGSEHCPRKTPLQKPSS
FALPAASRIMLLPTPICLEPDVQYFIDVYFSQSLEGGSYAHSHILVDSLGLLPQIHTSED
FCSKPDLDDYQLHTCVEIASEPGAQVLPGACERLIVSMSARLHNGAVACKCHPQGSVGTS
CSPLGGQCQCKPHVAGRCCDRCSTGSYGLGHHGCHSCHCHPQGSKGTVCDQITGQCSCWE
EVGGRHCDRCLQGYFGFPNCRPCLCNGFTELCDPETGSCFNCGGFTTGRNCERCMDGYYG
DPSSGQPCRPCPCPDVPSSNRYFAYSCYQNPWNSDVICNCPQGYAGKQCEECSPGFYGDP
RISGAPCRPCACNNNIDITDPESCSRVTGECLKCLHNTEGPNCQLCRPGHFGSALNQTCR
RCSCHPSGVNTTECPPGRGACLCDPETGTCPCLPNVTGQTCDRCADGHWNLVPGRGCQPC
DCDPRTSRGSHCDQVTGQCLCTLGYGGRRCSECQEDYYGDPLGRCIPCDCNREGTQKPIC
DQDTGMCRCREGVSGQRCEHCARGRGQEFPACPRCHLCFDQWDHTVSLLSTAVRRLMRLA
ADMEDKSKNLSVCEADFKGLRGNMSEIERILKHPVFSSGEFLKVKNYHGSVRKQIMQLSK
QLKTVYDFQDLKETVIKMMNESDLLLENLQEEIDFYSSAHNASIMDSSENIKKYYHRSSS
AEKKISEITSTINNSEKNRIDLLNILDTLTSKENVSLEKLKQIKIPDMQILKEKVCGERG
DMPCVRSSCGGPSCRDSLTLSRNALQKAQQTESMIHNLSNQAQELKNQIQNISKLAEVSQ
NSTLQLSENLRNMKNQSESEEEKMKLLIKTLKKFLLEENVPPEDIEKVANHVLDIHLPIT
SQNLTHELDKIQKLMQLGEDYRTDEDKLNKAADEAQKILVKAKAAVKAANVLSNLDRMLN
KLQQVQVIHGRANSTTTQLTAEISKIKKNVLQTENQAKETKNELDVAERQSALEDELFQL
WIKLQRNQEQAILAEAQAESARGQAGGLEEEFVELKNQYAILQHKTSATGLTKETIEKVK
QLKDAAEKLAGDAADKIRRITDLEKKIQDLNLSRQEKADQLKQLEDQVIAIKNEIVEQEN
KYTTC
NT seq 5238 nt   +upstreamnt  +downstreamnt
atgcaatttcagctgacctttcttttgcaccttgggttgctcagttatgcaaaagctgaa
gatggatgcaacaatcgtgcctgttatcccaccactggcaatctcctggtgggacgcagc
acacagctcacagcttcttctacctgtgggctagacggagcccagaaatactgcatcctc
agctacctcgagggggaacaaaaatgcttcatttgtgactccagatttccatacgaccca
cacacccaacccaacagccacaccattgagaatgtgattacaaattttgaaccagacaga
gaaaagaaatggtggcaatctgaaaacggtcttcatcatgtcagcatccgattggaccta
gaggcactatttcagttcagccaccttattctgacctttaagacgtttcggcctgccgca
atgctagttgaacgttccacagactatggacacacctggaaagtgtttaaatattttgca
aaagactgtgccacttcctttcccaacatcgcatccggccaggcccagggcgtgggagac
cttgtgtgtgactctagatattcggatgttgaaccctccactggcggtgaggttgtttta
aaagttttggatcccagctttgaaatagaaaacccgtacagcccctacatccaggacctt
gttacattaacaaacctgaggataaacttcaccaaactccacacccttggggatactttg
cttcgaaggatgcagaatgattcccttgataaatactactatgccgtgtatgagatggtg
gttcggggcagttgtttttgcaatggccatgctagcgaatgtggcctgacgcagacagtg
cggggagatgtgttcgcccctgctggaatggttcacggtcagtgtgtctgtcagcacaac
acagatggcccaaactgtgagcggtgcaaggacttcttccaggatgctccttggaggcca
gctgcaggcctccaggacagctcttgcagagcttgtagctgtaacagccactcggaccgc
tgtcactttgacatgaccgtgtacctggccagcggaggggtcagcgggggcgtgtgcgaa
gactgccggcacaacaccgaggggcaacactgccatcgctgcaggccccttttctacagg
gaccccctcaaggccatctcggatccttacgcgtgccttccttgtgaatgtgaccctgac
ggaaccgcatcgggtggcatttgtgtgagccactctgatcctgccttggggtctgtggct
ggccaatgcctgtgtaaggagaatgtcgtaggagccaagtgcgaccagtgcaagcccaac
cactatggactgagtgccgctgaccccgtgggctgtcagccctgcaactgtaaccctctg
gggagtctgccactctcgacctgtgatgtggacacaggtcagtgcctgtgccagccctcc
gccacgggaccacactgtgaggagtgtgtggttggatactggggactggaaaatcatctc
catggatgtgttccctgtgactgtgatattggaggtgcttattctaatgtgtgttctccc
gaggacgggcagtgtgagtgccgcccccacgtcgctggccgcagctgcactgaaccagcc
cccggctacttctttgtttctttgaatttctacatctatgaggccgaggaagccctgcca
ctccaaggacttgcccctttggggtctgcgactttcggccaggtgcctgctgttcacatt
gtcttccgagagccggttcccgggacgcctgttacctggactggacctggatttgccagg
gttctccctgggtctggcttaagattcgctgtccacaacattccctctcccatgaatttc
actgtggccattcgctatgaaactcagtctgcggctgactgggctgtccaggttgcagtt
aacccccctggaggaagcgagcactgtccacgcaagacccctctgcaaaagccttcatcc
ttcgccttaccagcagcttccagaatcatgctgcttcccacacccatctgtttagaacca
gatgtacaatatttcatagacgtctatttttcccagtctttggaaggagggtcctacgct
cattcacacatccttgttgattctctcggtcttcttccccaaatccacacatcggaggat
ttctgcagcaaaccggatttagatgactatcagctgcacacctgtgttgaaattgcctca
gaaccaggagctcaggtgctccctggtgcatgtgaaaggctcatagtcagcatgtctgcc
aggctgcacaatggggcagtggcctgcaagtgtcacccccagggctcagttgggaccagc
tgcagcccacttggaggccagtgccagtgtaagccacacgtggccgggcgctgctgtgac
aggtgctcaacaggaagctacggtttggggcatcatggctgtcactcatgtcactgccac
cctcaaggctcaaagggcactgtgtgtgaccaaataacaggacagtgctcctgctgggaa
gaggtgggtggccgccattgtgaccggtgcctgcagggctattttggatttcccaactgc
cgcccttgcctttgtaatgggttcacagagctctgtgatccagaaacaggatcgtgcttc
aattgcggggggtttacaacaggaagaaactgtgaaagatgcatggatggttactatgga
gatccttcctcaggacagccctgccgtccttgcccatgtccagatgttccctcaagcaat
cggtattttgcttattcctgttatcagaatccttggaattcagatgtaatctgtaattgt
cctcaaggttatgcaggaaagcagtgtgaagaatgctctcctggtttctatggagatcca
agaatttctggagcaccttgccggccatgtgcctgcaacaacaacattgatataactgat
ccagagtcctgcagccgagtgacaggggagtgccttaaatgtctgcacaacactgagggg
cccaactgccagctctgcagacctggtcactttggatcagccctcaatcaaacctgcaga
agatgttcctgtcatccttctggtgtgaataccactgagtgtccccctggtcggggagct
tgcctctgtgacccagaaactggcacatgcccttgtctgcccaatgtcacagggcagacc
tgtgaccgttgtgctgacgggcactggaacttggtacctggcagaggatgtcagccatgt
gactgtgacccccggacctctcgtggtagccactgtgaccaggttacaggccagtgtctg
tgtacattaggctatggtgggagacgctgcagtgagtgccaggaagattactatggtgac
ccactggggcggtgcattccatgtgactgcaacagggaaggtacccagaagcccatctgt
gaccaggacactggcatgtgtcgctgccgggaaggtgtcagcggccagcgatgtgagcac
tgtgcacggggtcgtggccaggaattccccgcttgtcctcgctgtcacttgtgctttgat
cagtgggaccacaccgtctctctcctctccacagcagtgcgccggctaatgaggctggcc
gctgacatggaagataaaagcaaaaacctgtctgtctgtgaggctgacttcaaaggcctc
agagggaacatgtctgaaatagaaaggattttgaaacatcctgttttctcatctggggag
ttcttaaaagtcaagaattatcatggctctgttcggaagcaaattatgcagctaagtaag
caactgaaaacagtgtatgactttcaagatctgaaagaaacagtaataaaaatgatgaat
gaatcagacctcttacttgaaaatcttcaggaagaaatcgatttctactccagtgcccat
aatgcaagcatcatggattcttcagagaacatcaagaagtattatcacagatcatcatct
gctgaaaaaaaaattagtgaaataacttccactataaataattctgaaaaaaacaggatt
gatttacttaacatcttagatacactaacctcaaaagaaaatgtgtcattggaaaaatta
aaacagattaagataccagatatgcaaatattgaaggaaaaggtgtgtggagagcgaggg
gacatgccatgtgtgcgctcgtcatgtggtggcccaagctgtcgtgactccctgaccctc
tcgaggaatgcccttcagaaagctcagcaaacagaatccatgattcacaatttgagcaat
caggcacaagagctgaagaatcagatacaaaatataagtaaactggcagaagtttcccaa
aacagtaccttacagttaagtgagaatctgaggaatatgaaaaaccaaagtgaatctgaa
gaagaaaaaatgaaacttttaatcaaaacactgaaaaagtttttgttagaggaaaatgtg
cctccagaggacatagaaaaggttgcaaatcatgtacttgacatccacctgccaataaca
tcacaaaacctaacccatgaacttgacaaaatacagaaacttatgcagcttggtgaggac
tacaggacagatgaggacaagctaaataaagcagcggatgaagcacagaagattttggtg
aaggcaaaagcagctgtaaaagcagcgaatgttctatcaaatcttgacagaatgttgaat
aagttgcaacaagttcaagtcattcacggacgggcaaattctaccaccacacagctgact
gccgagatatcaaaaataaaaaagaatgtcctgcagactgaaaatcaagccaaggagact
aagaatgaactggacgttgcagagcggcagtcagctctggaggatgaactcttccagctg
tggatcaagttgcaaaggaatcaagagcaagccattcttgcggaagctcaggctgaatcg
gcccgaggccaggccgggggccttgaggaggagtttgttgaactaaagaatcaatatgct
attcttcaacataagacaagcgcaacaggactgacaaaggaaacaattgaaaaagtgaaa
cagctaaaagacgcagcagagaaattggctggagatgcagcagacaagataagaagaata
acagatttagaaaagaagatccaagatttgaatctaagtagacaagaaaaagctgatcaa
ctgaaacagttggaagatcaagtcattgccattaaaaatgaaattgttgagcaagaaaat
aaatatacaacctgttag

KEGG   Desmodus rotundus (common vampire bat): 112302957
Entry
112302957         CDS       T05907                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112302957 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112302957 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112302957 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112302957 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112302957 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112302957 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112302957 (LAMB1)
   05145 Toxoplasmosis
    112302957 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Other DBs
NCBI-GeneID: 112302957
NCBI-ProteinID: XP_024414208
LinkDB
Position
Unknown
AA seq 1786 aa
MGLLQVFAFSVLAVFGVRVRAQEPEFSYGCAEGSCYPATGDLLIGRAQRLSVTSTCGLHT
PEPYCIVSHLQEDKKCFVCNSQEPYHETLNPDSHLIENVVTTFAPNRLKMWWQSESGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVSEEVEGMVHGHCMC
RHNTKGLNCELCLDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVSGG
VCDDCQHNTMGRGCEQCRPFYYQHPERDIRDPNFCEPCTCDPAGSQNGGVCDSYTDFSAG
LIAGQCRCKLYVEGEHCDICKEGFYGLSAEDPFGCKSCACNPLGTIPGGNPCDSASGYCY
CKRLVIGQHCDQCLPEHWGLSNDLDGCRPCDCDIGGALNNSCSSESGQCTCRPHMIGRQC
NEVEPGYYFTTLDHYIYEAEEANFGPGVTVVERQYVQDRVPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGKIPTSSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSAVESPYTLIDSLVLMPFCKSLDIFTVGG
SGDGSIMNSAWETFQRYRCLENSRSVVKTPMTDVCRNMIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCDRCAPGNFGFGPSGCKPCECHLQGSVNAFCDPITGQC
HCFQGVYARQCDRCLPGYWGFPGCQPCQCNGHADDCDSATGECLSCQDYTMGHNCERCLS
GYYGDPIIGSGDHCRPCPCPDGPGSGRQFASGCYQDPVTLQLACVCNPGYIGSRCDDCAP
GFFGNPSDVGGTCQPCHCHHNIDTTDPEACDKETGRCLKCLYHTEGEHCQLCRFGYYGDA
LQQDCRKCVCNSLGTVQEHCNSSDCQCDKATGQCLCLPNVVGQNCDRCAPNTWQLASGTG
CDPCNCDAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECRACDCDPRGIE
TPQCDQSTGHCVCIEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTQKF
LEKAKALKLSGVIGPYRETVDSVEKKVSEIRDILAQSPAAEPLKNIGNLFEEAEKLTKEV
TEKMAQVEVKLSDVASQRNRTAKDLDSLQTEAESLDNTVQELAEQLEFIKNSDIRGALDS
ITKYFQTSLEAEKRVNASTIDSNSTVEQSALTRDRVEDLMLERESQFREKQEEQARLLDE
LAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGQKKCGGPGCGGLVTAAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKLKADEAKQNAQDVLLKTNATKEKVDKSNEDL
RDLIKQIRDFLTQDGADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVI
LQQSAADIARAEMLLEEAKKASKSATNVKVTADMVKEALEEAEKAQIAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYAVK
QSAEDVKKSLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KELERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVTIYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atggggctgctccaggtgttcgctttcagtgtcttagcggtgttcggggtccgagtgcgt
gctcaagaaccggagttcagctatggctgcgcggagggcagctgctacccagccaccggc
gaccttctcatcggccgagcacagaggctttcggtaacctcgacgtgcgggttgcacaca
cccgagccttactgcatcgttagccacctccaggaggacaaaaaatgcttcgtatgcaat
tcacaagagccttatcatgagaccctcaatcctgacagtcatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatgtggtggcaatctgaaagtggcgtggaaaat
gtaaccatccaactggatttggaagcagaattccattttactcatctcattatgaccttc
aagacattccgcccagccgctatgctgatagaacggtcatctgactttgggaaaacgtgg
ggtgtgtacagatactttgcttatgactgtgagagctcctttccaggcatttctactggt
cccatgaagaaagtcgacgatataatttgtgattcccgatattctgacattgaaccatca
acagaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaagatccttat
agtccaagaatacagaatctcttaaaaatcaccaacttgagaatcaaatttgtgaaactg
catactttgggagataaccttttggattccagaatggaaatcagagagaagtactactat
gccgtgtatgacatggtggttcgaggaaattgcttctgctacggccatgccagcgaatgc
gcccctgtggatggggtcagcgaggaggtagaaggaatggttcatgggcactgcatgtgc
aggcataataccaagggcttaaactgtgagctgtgcctggatttctaccacgatttaccc
tggcggcccgctgaaggtcgaaacagcaatgcctgtaaaaagtgtaactgcaatgaacac
tccagctcatgccactttgacatggcggtctacctggccactggaaacgtcagtggagga
gtgtgtgatgactgtcaacacaacaccatgggacgcggctgcgagcagtgcagacccttt
tactaccagcacccggagagagacatccgcgatcctaacttctgtgaaccatgtacctgt
gacccggccggttctcagaacgggggagtctgtgacagttacacagatttttccgctggc
ctcattgctggtcagtgtcggtgtaaattgtatgtcgaaggagaacactgtgacatttgc
aaagaaggtttctatggtttaagtgctgaagatccatttggttgtaaatcttgcgcctgc
aatcctctgggaacaatccctggcgggaatccttgtgactccgcgagtggttactgctac
tgtaagcgtctggtgataggacagcattgtgaccagtgtctgccggagcactggggctta
agcaacgatttggatggatgtcgaccttgtgactgtgacattgggggagccttaaacaat
agctgttcctcggagtcgggccagtgcacatgccgaccccacatgatcggacgtcagtgc
aacgaggtggagccgggctactactttaccaccttggaccactacatctatgaagcagaa
gaagccaactttgggcctggggtcaccgtagtggagcggcagtatgtgcaggaccgggtt
ccctcctggactggagcgggctttgtccgggtgcccgaaggggcttatttggagtttttc
attgacaacataccatactccatggagtacgacatcctaattcgctacgagccacagcta
cccgaccactgggaaaaagctgtcatcacagtgcaacgacctgggaagattccaaccagc
agccgatgcggtaacacagttcctgatgatgacaaccaggtggtgtccttatcacctggc
tcgaggtacgtcgtccttccacgccctgtgtgctttgagaagggtgtgaactacacagtc
aggttagagctgccccagtacacctcctccgatagcgctgtggagagtccctacacgctt
atcgattcacttgtcctcatgccattctgtaagtcactggacatcttcaccgtgggaggt
tcgggagatgggtccatcatgaacagtgcctgggaaacctttcagagataccgatgtctg
gagaacagcagaagcgttgtgaaaacgccgatgactgacgtttgcagaaacatgatcttt
agcatttctgccctgttacaccagacaggcttggcttgtgagtgcgaccctcagggctcg
ttaagctccgtctgtgaccccaacggaggccagtgccagtgccggccgaacgtggttggg
agaacctgcgacagatgtgctcctggaaactttggcttcggccccagtggatgcaaacct
tgtgagtgccatctgcaaggatctgtcaatgctttctgcgaccccatcactggccagtgc
cactgtttccagggggtgtatgctcggcagtgtgaccggtgcttacctgggtactggggc
tttccgggttgccagccctgccagtgcaatggccacgctgatgactgtgactcggcaaca
ggggagtgcttgagctgccaggactataccatgggccataactgtgaaaggtgcttgtcc
ggttactatggtgatcccatcattgggtcaggagatcactgccgcccttgtccttgccca
gatggtcccggcagtggacgccagtttgccagtggctgctatcaagatcctgttactcta
cagcttgcgtgcgtctgtaatcctgggtacattggctccaggtgcgatgactgtgccccg
ggcttctttggcaatccctctgatgttggggggacatgtcagccttgccactgtcaccac
aacattgacacgacagacccagaagcctgtgacaaggagactgggaggtgcctcaagtgc
ctgtaccacacggaaggggagcactgccagctctgccgatttggttactatggggacgcc
ctccagcaggactgtcggaagtgtgtctgcaattccctgggcaccgtgcaggagcactgt
aacagctctgactgccagtgcgacaaagccacgggccaatgtttgtgtcttcctaatgtg
gtcgggcagaactgtgaccgctgtgcgcccaacacctggcagctggccagcgggactggg
tgtgacccctgcaactgcgatgctgctcattccttcgggccatcttgtaatgagttcacg
gggcagtgccagtgcatgcctggctttgggggccgcacctgcagcgagtgccaggagctc
ttctggggagaccccaatgtggagtgccgagcctgtgactgcgaccccaggggtattgag
acgccacagtgtgaccagtccaccggccattgtgtctgcattgagggtgtcgagggtcca
cgctgtgacaagtgcactcgagggtactcgggggtcttccctgactgcacaccctgccac
cagtgctttgctctctgggacgtgatcatcgctgagctgaccaacaggacccagaagttt
ctggagaaagccaaggccttgaagctcagtggtgtgattgggccttaccgggagactgtg
gactccgtggagaagaaagtcagtgagatcagagacatcctggcccagagcccagctgca
gagccactgaaaaacatcgggaatctttttgaggaagcagagaaactaaccaaagaagtt
acagaaaagatggctcaagtagaggtgaaattatctgacgtagcttcacagagaaaccgc
acagccaaagacctagattctctccagacagaagcagaaagcctcgacaacacagtacaa
gagcttgctgaacaactggaatttatcaaaaattcagatattcggggcgccctggatagc
attaccaagtatttccagacatctctggaggcagagaagagggtgaacgcctccaccata
gattccaacagcacggtggagcagtcggcgctcaccagagacagagtagaagacttgatg
ctggagcgagagtcccagttcagggaaaaacaagaggaacaggcccgccttctggatgaa
ctggcaggcaaactacaaagtctagacctctcagccgctgccgaaatgacctgtgggacg
ccgccaggggcctcctgctccgagactgaatgtggcggccccaactgcagaactgacgaa
ggacagaagaagtgtggggggcctggctgtggtggcctcgtcactgctgcacacagcgcc
tggcagaaagccatggacttcgaccgagacgtcctgagtgccctggctgaggtcgaacag
ctctccaaaatggtctctgaagcaaaactgaaggcagatgaggccaaacagaatgctcag
gatgtcctgttgaaaaccaacgcgaccaaggaaaaagtggacaagagcaacgaggatctg
cgagatctgatcaagcagatcagagactttttgacccaggatggtgctgatttggacagc
attgaagctgttgctaatgaagtattgaaaatggaaatgcctagtaccccacagcagtta
cagaacttgacagaagatattcgcgagcgagttgaaagcctttctcaagtggaggttatt
ctacagcaaagtgctgctgacattgccagagctgagatgttgttagaagaagccaaaaaa
gccagcaagagtgcaacaaatgttaaagtcactgcagacatggtaaaggaagctctggaa
gaagcagagaaggcccagattgcagcagagaaggcaattaaacaagcagatgaagacatc
caaggaacccagaacctactaacttcgattgagtctgaaacagcagcttccgaggagacc
ttgttcaatgcctcccagcgcatcagcgagctggaaagaaatgtggaagaacttaagcgg
aaggcagcccagaactctggggaggcagaatatattgagaaagtagtatatgctgtaaaa
caaagtgcagaagatgttaagaagtctctggatggtgaacttgatgaaaaatataagaaa
gtagaaaatttaattgctaaaaaaactgaagagtcagctgatgccagaaggaaagctgaa
atgctacaaaatgaagcaaaaacacttttggctcaagcaaacagcaagctgcaactcctg
aaagagttagaaagaaaatatgaagacaatcaaaaatatttagaagataaagctcaagaa
ttagtaagattggaaggagaagtccgttcactcctaaaggatataagccagaaagttact
atttatagcacctgcttgtaa

KEGG   Desmodus rotundus (common vampire bat): 112303887
Entry
112303887         CDS       T05907                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112303887 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112303887 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112303887 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303887 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112303887 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112303887 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112303887 (LAMA5)
   05145 Toxoplasmosis
    112303887 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 112303887
NCBI-ProteinID: XP_024415223
LinkDB
Position
Unknown
AA seq 3789 aa
MLRARLRGPAQRDPARLAPALTLALTPAYSPREPVPGNAAYLLPPPRAPRDLAVPAPTVS
PRRRGRRAALTGGRGETALRGRLSECASQTSRGTDPAEVAEEEHFWVSWKIGADGCVSDA
GPSGESLIVALGGFSYIWKPALVQQCLLSLPRSPSRWASGGQYCDICTAANSNKAHPASN
AVDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTDFG
HTYQPWQYFASSRRDCLERFGAQTLERISKDDDVICSTEYSRIVPLENGEIVVSLVNGRP
GAMNFSYSPLLRDFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGR
CVCHGHADVCDAKDPTDPFRLQCACQHNTCGTACERCCRGFNQRPWEPATPDSANECQAC
HCHGHAEDCYYNPTADQHNTSQGPGSISQGGGVCIDCQHHTTGVNCELCLPGFYRSPDHP
LDSPHTCRRCDCQSEFMDGTCEDLTGRCYCRRNFTGDRCEECAAGFTGFPHCHPVATTHN
SSGAQALPAGQIVNCDCNAAGTQDNACQRDARAGRCLCKPNFQGDHCELCAPGFHGPDCQ
PCQCSSPGVLHSDCDQDSGQCSCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPTGC
DGAGRCPCRPEFDGPHCDHCRPGHHGYPDCRACNCNPHGALDQLCGAGGTCRCRPGYAGT
TCQECSPGFHGFPACAPCHCSAEGSLHAVCDARSGQCSCRPRVTGLRCDTCELGTYSFPA
CEAGSCHPAGLAPGDHVRPEAQAPCTCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCD
PRGTLGGAAQCQLGNGQCFCKPHVCGQTCAACKDGFFGLDRADYFGCRSCRCDVGGALGQ
GCEPRTGXXXXXXXXXXXXXGGPARNHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFE
NFSWRGYAQMAPIQPRIVARLTVTSPDLFWLVFRFVNRGPTSVSGRISMQEESKFASCAN
CTEQSQPVVFPPSTEPAFITVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVALLPSAYYE
AALLQLRATEACMFRPAAQGSGENCLLYAHLPLDGFPSAPGPGALCLQDNSLPRPCPMER
LSPAHPPLVLCQGSDVDVQLQVAVPRPGRYALVVQYANEAAHQELGVAVHTPRQPPQQGL
LTLHPCLYSTLCRGAALDHQHLPAVFHLDTDASIRLTAEQAHFFLHSVTLVPMETFSLEF
VEPQVHCVSSHGAFSPSSAACLPSRFPKPPQPIVLRDCQVLPLPPGLPLTLSQDLTPGAP
PPEPQPRPPTAMDPDAEPTLLRHPQGTVVFATHVPALGRYAFLLHGYQPTHPTFAVEVLI
NGGRIWQGHANATFCPHAYGCRVLVVCEGQAILDVTDSELTVTVRVPKGRWLWLEYVLVV
PEDAYSSSYLREEPLDKSYDFISQCASHGYHISPTSSSQFCRDAATSLSLFYNNGARPCG
CHEVGATDPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPNCRPCDCSGRLCEELTGRCV
CPPRTVPPDCAVCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDKDSGQCQCRPHVAGR
RCDTCAPGFYGYPGCRPCDCLHAGSAPGVCDPITGQCRCKENVQGPRCDQCRVGTFSLDA
ANPKGCTRCFCFGATERCQSSLHGRQELVDMEGWTLMSSDRQVVPHELREEGSLLYADLR
RIPEGFPELYWQAPPSYLGDRVSSYGGTLRYELHSEIQRGDVFLPTESRPDVVLQGNQMS
IMFLEPVYPEPGQGHRGQLQLVEGNFRHTETHSAVSREELMMVLAGLQQLQVRALFSKVS
SAVSLRRVALEVAAETGRGPPASNVELCMCPANYLGASCQECAPGYYRDVKGLFLGRCVP
CQCHGHSDLCVPGVGTCMGCQHNTEGDHCERCQAGFVRSGSEDPAAPCVSCPCPVSVPSN
NFAVGCVFTGGRAQCLCKPGYAGATCERCAPGFFGNPLVLGSSCQPCNCSGNGDPNLLFN
DCDPLTGACRTCLHNTAGPHCETCAPGFYGNALLPGNCTRCNCSPCGTEACDPHSGQCLC
KAGVTGPRCDRCQEGYFGFEGCGGCRPCTCGPASEGSECHPQSGQCHCRPGAGGLQCREC
AAGHWGRPEQGCRRCQCQGGHCDVHTGRCTCPPGLSGDRCDTCSQQHQVPVPGRPGGPGV
HWGVCDHCVVLLLDDLERLGSLLPAIREQLRGINTSSVAWAQLHRLNASIADLQSQLRSP
AGPRHETARQLEELEGQSESLRQDTQRLDRQATGAQVQAGQLLTSTEATLGRAQTLLATI
QALGRTLSELMTDHLLPANATAPSGEQLHQTLAKVERMLGEMRARDLGAPRAAAEAELGE
AQRLLARVQEQLTSRWEGNQALAARTREQLAQHEAGLMDLREALNRAVGTTRETEELNSR
NQERLEEALRRKQELSQDDAILRDTLQAARETLARASELLQGMDRAKEEYERLAAGLDGA
RTPLLEKIRTFASIDSRVELVEAAEAHAQQLDQLAHNLSSIIRGVNQDRFIQRAIEAANA
YSSILRAVQAAEGAAGQALQQASSAWEMVVQQGLASQARGLRANSSALEEAILGEQRRLG
HVWATLQGTGTQLSDARARKEQLAARVREVQAMLAMDTNETSKKIAHAKVVATEAQDTAA
RVQSRLRDMQRNLEQWQGQYGGLQGQDLGQAVLDAGRSVSTLEKTLPQLLAKLNLLENRG
AHNASLALSTSIGRVRELIAQARGAASKVKVSMKFNGNSGVQLRAPRDLSDLAAYTALKF
YLQSPEPGPNQLSEDRFVLYMGSHQAAGDYMGVALRDQKVHWVYRLGAAGPANLSVDESI
GEQFAAVSIDRTLQFGHMSVTVENRVIHETKGDTVAPGAEGLLSLHPDDFVFYVGGYPSS
FMPPEPLRLPGYKGCIEVSTLNEEVISLYNFERTFWLNTAVDKPCPRSKSTGDPWLTDGS
YLEGSGFAHIKAVSQSSNTKRFEQELRLVSSNGIIFFLQHQGQFLCLAVMDGSLHLLYDF
GEGLKEAVPMLTRPFLTSTSKAIQVLLLGGGRQRRVLVRVERANMFSVDQGSVLELADSY
YLGGVPLGQLPPSLQQLFPTGGSVRGCVKGIKALGKYVDLKRQNTTGISAGCTADLLVGR
AMTFHGRGFLPLALPDVAPLTGHVYSGFGFRSTQDSGLLYHRASPDGPCSVSLKQGHVTL
RFVRTEVKSSGGFADGAPHYVAFYSNATGVWLYVDDQLQQTVPHRGLPSRPRPPPTEPPQ
LLLGGLPESDTFRNFSGCISNVFVQRLEGPQRVFDLQQNLGGISVSSGCPPAPGPPPSPA
PQGLRATAARKASRRSRQPAQDPACTPQPLGIIQGTYQFGGPLPSYLEFTGIPAPLSNRS
RLAMLVRPRSRSGLLALAVPLTSGSPSLTLFLSHSYFVAQAAGGPVPQLRVQSRLRCQAD
RWHQVSVRWDNARVQLGVNGVWAQSREQTDKQHQGAEAPQPHTLFVGGLPLGSQHSHRLP
VAVSSSRFSGCVRRLGLDGRLLRTPHTMMGVTPCLSEPLERGLFFAGGRGALTLDTLGTT
LPNMSLQLEVRPQTATGLLFHLGQLQATPYLQAQVLGKQVLLRADDGAGAFSTAVTLSRA
LCDGQWHQLAVTKDGSALQLEVDAQSSWTLGPALEASVHAPAPLHLGGLPELKDTQNGPP
TLPHPWPPVFQGCMRNLRVNGSLVTLPHSVRVQGAVGASGCPGRRGPASRKTRPPKQPAN
QATLSQSHR
NT seq 11370 nt   +upstreamnt  +downstreamnt
atgttgagagcgcgcctgcggggccccgcgcagcgcgaccccgcgcgcctagcccctgcc
ctgaccctcgccctgacccctgcctacagcccccgcgagccggtaccaggcaacgcggcc
tacctgctgccaccgccacgagcaccgagagatctcgcggttccggctcccaccgtgagc
ccgcgtcggcgagggcggcgcgcggcgctcacgggcggccggggcgagacggcgctgcgg
ggtcgtctatcagaatgcgcatcgcagaccagtcggggaacggaccccgcggaagtagcc
gaggaggagcacttctgggtgtcgtggaagataggagcagacggatgtgtcagtgacgct
ggcccgtctggcgagagcctcatcgtggctctgggagggtttagctacatctggaaacca
gcgctggtgcagcagtgcctgctgtcgctcccacggagccctagccgctgggcatcagga
ggccagtactgcgacatttgcacggctgccaacagcaacaaggcgcaccccgcgagcaac
gccgtcgatggcaccgagcgctggtggcagagcccgccactgtcccgcggcctggagtac
aacgaggtcaacgtcaccctggacctgggccaggtcttccacgtggcctacgtgctcatc
aagtttgccaactccccgcggccagacctctgggtgctggagcgctccaccgacttcggc
cacacctaccagccgtggcagtactttgcctcctccaggagggactgcctggagcggttc
ggggcgcagacgctggagcgcatctcgaaggatgacgatgtcatctgcagcacggaatac
tcccggatcgtgcccctggagaacggcgagatcgtggtgtccctggtgaacgggcgcccg
ggggccatgaacttctcctactcgccgctgctgcgcgacttcaccaaagccactaatgtc
cggctgcgcttcctgcgtaccaacacgctgctgggccacctcatgggcaaggcgctgcgg
gaccccaccgtcacccgccggtactattacagcatcaaggacatcagcattggcggccgc
tgcgtctgccacggccacgcggacgtctgcgacgccaaggaccccacagaccccttcagg
ctgcagtgtgcctgccagcacaacacctgcgggactgcctgtgagcgctgctgccgcggc
ttcaaccagcggccgtgggagccagcgacgcccgacagcgccaacgagtgccaggcctgc
cactgccacggccacgcggaggactgctactataaccctacagcggaccagcacaacacc
agccagggcccaggcagcatctcccaaggcgggggcgtgtgtatcgactgccagcaccac
accaccggcgtcaactgtgagctctgcctgcccggcttctaccgctccccagaccacccc
ctggactcgccccacacctgccgtcgctgcgactgccagtcggagttcatggacgggact
tgcgaggacctgactggccgttgctactgccggcgcaacttcaccggggatcggtgtgaa
gagtgcgctgcaggcttcacgggcttcccacactgccaccccgtggccaccacccacaac
agcagcggggcgcaggcgctgcctgctggacagatcgtgaactgtgactgcaatgccgcc
gggacccaggacaacgcctgccagcgggacgcgcgggcgggacgctgcctgtgcaaaccc
aacttccagggcgaccactgtgagctctgcgccccgggcttccacggccccgactgccag
ccgtgccagtgttccagccccggagtgctgcacagtgactgtgaccaagactcgggtcag
tgctcctgccgggtgggcttcgagggagccacgtgtgaccgctgtgcccctggctacttc
cacttccccctctgccagttgtgcggctgcagccctgcagggaccctgcccacaggctgc
gacggggctggccgctgcccctgccggcccgagtttgatggtccccactgtgaccactgt
cgtccaggccaccatggctaccctgactgccgcgcctgcaactgcaacccccacggggcc
ctagaccagctctgtggtgcgggcgggacatgtcgctgccgccctggctacgccggcacc
acctgccaggagtgcagccccggtttccacggcttccctgcctgtgccccctgccactgc
tcggcagaaggctccttgcacgccgtctgtgatgcccgcagcgggcagtgcagctgccgg
ccccgcgtgacagggctgcggtgcgacacctgcgagctcggcacctacagcttccccgcc
tgcgaagccggctcctgccaccctgctggcctggcgccaggcgaccacgtccgtcctgag
gcacaggccccctgcacgtgccgggctcacgtggaggggccaagctgcgatcgctgtaaa
cctgggttctgggggctgagtcccagcaaccccgagggctgcacccgctgtagctgcgac
cccagaggcacgctgggtggggccgcccagtgccagttgggcaacggtcagtgcttctgc
aagcctcacgtatgcggccagacctgcgcggcttgcaaggatggcttcttcggactggac
cgggctgactactttggctgccgcagctgccggtgcgatgttggcggagcgctgggccag
ggctgtgagccgagaacgggcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnt
ggggggccggcgaggaaccactacctccccgacctgcaccacctgcgcctggagctggag
gaggcggccacgcccgagggccatgccgtgcgcttcggcttcaaccccctcgagttcgag
aacttcagctggcggggctacgcgcagatggcgcccatccagcccaggattgtggccagg
ctgaccgtgacctcccctgacctcttctggcttgtcttccgctttgtcaaccgcgggccc
accagtgtgagcgggcgcatctctatgcaggaggagagcaagtttgcctcctgcgccaac
tgcacagagcagagccagccggtggtcttcccgcccagcacggagcccgccttcatcact
gtgcctcagaggggctttggggagcccttcgtgctaaaccccggcacctgggccctactc
gtggaggccgaaggggtgctcctggactacgtggccctgctgcccagcgcctactacgag
gcggccttgctgcagctgcgggcaaccgaggcctgcatgttccggcccgctgcccagggc
tctggagagaactgcctgctctacgcccacctgcccctggacggcttcccctctgcccct
gggcccggggccctgtgcctgcaggacaatagcctgccccggccctgcccgatggagcgg
ctcagccctgcacaccccccactggtcctctgccagggcagtgatgtggacgtccagctg
caggtggcggtgccgaggccaggccgctatgccctggtggtgcagtatgccaacgaggcg
gcccaccaggagctgggtgtggccgtgcacaccccccggcagcccccccagcaggggttg
ctcaccctgcacccctgcctgtacagcacgctgtgccggggtgccgctctggaccaccag
cacctcccggcagtcttccacttggacacagacgccagcatccgactcaccgccgagcag
gcacacttcttcctgcatagcgtcaccctggtgcccatggagacattcagcttggagttt
gtggagccccaggtccactgcgtcagcagccacggggccttcagccccagcagtgccgcc
tgcctgccctcccgcttcccgaagccgcctcagcccatcgtcctcagggactgccaggtg
ctgccgctgccgcctggcctccctctgaccctctcgcaggatctcacgccaggtgccccc
cctcccgagccccagccgcggccccccaccgccatggaccccgatgctgagcccaccttg
ctgcggcacccccagggaacggtggtctttgccacccacgtgcccgccttgggccgctac
gccttcctgctgcacggctaccagcccacccaccccaccttcgcagtggaggtcctcatc
aacgggggccgcatctggcagggccacgccaacgccaccttctgcccacacgcctatggc
tgccgtgtcctggtggtgtgtgagggccaggccatcctggacgtgaccgacagcgagctc
actgtgaccgtgcgagtgcccaagggccggtggctctggctggagtacgtgctggtggtc
cctgaggacgcctacagctccagctacctccgggaggagcccctggacaagtcctacgac
ttcatcagccagtgtgccagccatggctaccacatcagccccaccagctcatcccagttc
tgccgtgatgccgccacctccctgtccctcttctacaacaatggggctcggccttgcggc
tgccatgaagtgggggccaccgaccctacctgtgagcccttcggaggccagtgtccctgc
cgtgcccatgttattggccgagactgctcccgctgcgccaccggctactggggtttcccc
aactgtaggccctgcgactgcagtggccgcttgtgcgaggagctgaccggccgctgcgtc
tgcccgcctcgcacggtcccgcccgactgcgccgtctgccagccccagacctttggctgc
caccccctggtcggctgtgaggagtgcaactgctcggggcccggggtgcaggagctcaca
gaccccacctgcgacaaggacagcggccagtgccagtgcagaccccacgtggccgggcgc
cgctgtgacacctgtgcccctggcttctacggctaccccggctgccgcccctgtgactgc
ctccacgcgggctctgcgcctggcgtgtgtgaccccatcacgggccagtgccgctgcaag
gagaatgtccagggccccagatgtgaccagtgccgcgttgggaccttctccctggacgct
gccaaccccaaaggctgcacccgctgcttctgcttcggggccacagagcgctgccagagc
tccctccacggccgccaggagttggtggacatggagggctggacgctgatgagcagcgac
cggcaggtcgtgccccacgagctgcgggaagagggcagcctgctctacgcggacctgcgg
cgcattcctgagggattcccagagctgtactggcaggcgccaccctcctacctgggggac
cgggtgtcatcctacggggggaccctccgctatgaactgcactcagagatccagcgtgga
gacgtgttccttcccacggagagcaggccggacgtggtgctgcagggcaaccagatgagc
atcatgttcctggagccggtgtacccggagcccggccaggggcaccgagggcagctgcag
ctggtggagggaaacttccggcacacggagacccacagcgccgtgtcccgcgaggagctc
atgatggtgctggcaggcctgcagcagctgcaggtccgcgccctcttctccaaggtctcc
tcggccgtctccctgcgcagggtggcgctggaggtggctgctgagacgggcagggggcct
ccagccagcaacgtggaactgtgcatgtgccctgccaactacctcggggcctcctgccag
gaatgtgcccccggctattaccgggacgtcaaagggctctttttgggtcgctgtgtcccc
tgtcagtgccacggtcactcagacctctgcgtccctggcgtgggcacctgcatgggctgc
cagcacaacaccgagggcgaccactgcgagcgttgccaggccggcttcgttcgcagtggg
tccgaggaccccgcagccccctgcgtcagctgcccctgccccgtttcagtgccttccaac
aacttcgcggtgggctgcgtcttcacgggaggccgcgcgcagtgtctgtgcaaacctggc
tacgccggagccacctgcgagcggtgcgccccgggctttttcgggaacccgttggtgctg
ggcagctcgtgccagccctgcaactgcagcggcaacggggaccccaacctgcttttcaac
gactgcgaccccctgacgggcgcctgccgcacctgcctgcacaacaccgctgggccccac
tgcgagacctgcgcccccggcttctacggcaacgccctgctgcccggcaactgcacccgg
tgcaactgctccccatgtgggacggaggcctgtgacccccacagtgggcagtgtttgtgc
aaggctggtgtgacggggcctcgctgtgaccgctgtcaggaaggatatttcggcttcgag
ggctgtgggggttgccgcccatgtacctgtggaccagcctcggagggctctgagtgccac
ccccagagtgggcagtgccactgccggccgggggccgggggcctccagtgccgagagtgt
gccgccggccactgggggcgcccagagcaaggctgcaggcgttgccagtgccaggggggc
cactgtgatgtgcacacaggccgctgcacgtgccccccggggctcagtggggaccgctgc
gacacctgcagccagcagcaccaggtgccagtgcctggcaggcctgggggccctggtgtg
cactggggagtgtgtgaccactgcgtggtcctgctgctggacgacctggagaggctcggc
agcctcctccccgccatccgggagcagctgcggggcatcaacaccagctctgtggcctgg
gcccagctgcacaggctgaatgcctccatcgctgacctacagagccagctccggagccct
gcaggcccccgccacgagactgcacggcagctggaggaactggaggggcagagtgagagc
ctcaggcaggacacccagcggctggaccgacaggccacaggggcccaagttcaggctggc
cagctgctgaccagcacggaggcgacactgggtcgggcacagacactgttggcgaccatc
caggctctgggccgaaccttgagcgagctcatgacagaccacctgctgccggccaatgcc
acggccccgtcgggcgagcagctgcaccagacactggccaaggtggagcggatgctgggg
gagatgcgggcccgtgacctgggggccccacgggcagcggctgaggctgagctgggcgag
gcccagagattgttggcccgcgtgcaggagcagctgaccagccgctgggaggggaaccaa
gccctggccgcccgcacccgagagcagctggcccagcatgaggccggcctcatggacctg
cgagaggccctgaaccgggcggtgggcaccacgcgggagactgaggagctcaatagccgc
aaccaggaacgcctggaggaggccctgcgtcggaagcaggagctgtcccaggatgacgcc
attctgagggacactctgcaggctgccagggagaccctggcccgggcctctgagcttctg
cagggcatggaccgggccaaggaggagtacgagcgcctggccgccggcctggacggagcc
cggacgccactgctggagaagatccgcaccttcgcctccatcgacagcagggtggagctg
gtggaggctgccgaggcccatgcgcagcagctggaccagctggcgcacaacctctccagc
atcatccggggagtcaaccaggaccgcttcattcagcgcgccatcgaggccgccaacgcc
tacagcagcatcctgagagctgtgcaggctgctgagggcgccgcgggccaggcactgcag
caggccagcagcgcatgggagatggtggtccagcagggcttggcttcccaggcccggggg
ctgcgggccaacagcagtgccctggaggaggccattctcggggagcagcggaggctgggc
cacgtgtgggccaccctccagggcactgggacccagctcagtgatgcccgggccaggaag
gagcagctggcagccagagtgcgggaggtgcaggccatgctggctatggacacaaatgag
accagcaagaagatcgctcacgccaaggtggtagccaccgaagcacaggacacagcagcc
cgtgtgcagtcccggcttcgggacatgcagaggaacctggagcagtggcagggccagtat
gggggtctgcagggccaggacctgggccaggcggtgctggacgcaggccgctcagtgtcc
actttggagaagacactgccgcagctgctggccaagctgaaccttctggagaaccgcggg
gcacacaacgccagcctggccctgtccaccagcatcggccgcgtgcgggaactcatcgcc
caggcccgaggcgccgccagcaaggtcaaggtgtccatgaagttcaacgggaactcaggg
gtgcagctgcgcgccccccgggacctcagcgacctcgctgcctacactgccctcaagttc
tacctccagagcccagagcctgggcctaaccagctctctgaggatcggtttgtgctgtac
atggggagccaccaggctgctggcgactacatgggtgtggccctccgagaccagaaggtg
cactgggtgtaccgcctgggggctgcgggccccgccaacctcagcgttgatgagagcatt
ggggagcagtttgcagctgtcagcattgacaggaccctacagttcggtcacatgtctgtc
acggtggagaatcgggtgatccatgagaccaagggtgacacggtggcccctggggctgaa
gggctgctcagcctacaccccgacgactttgtcttctatgtggggggctaccccagcagc
ttcatgcccccagaacccctgcgcctccccgggtacaagggctgcattgaggtcagcacg
ctcaacgaggaggtgatcagcctctacaactttgagcggaccttctggctcaacacggcg
gtggataagccttgtccacgctccaagtcgaccggagacccatggctcacagatggctcc
tacctggagggctctggcttcgcccacatcaaggcagtcagccagtccagtaacaccaag
cgcttcgaacaggagctgcggctggtgtcctccaatgggatcatcttcttcctgcagcac
cagggccagttcctgtgcctggcagtgatggacggcagtctccaccttctctatgacttc
ggggagggcctgaaggaggctgtcccgatgctgacccggccattcctgacctcgaccagc
aaggcaatccaggtgttactgctggggggcggccgccagcgtcgtgtgctggtgcgcgtg
gagagggccaacatgttcagcgtggaccagggcagtgtgctggagctggccgactcctac
tacttagggggcgtgccgctgggccagttgcccccgagcctgcagcagctctttcccacc
gggggctccgtgcgaggctgtgtcaagggcatcaaggctctgggcaagtacgtggatctc
aagcggcagaacaccacgggcatcagcgccggctgcactgcggacctgctggtgggacgg
gccatgacattccacggccgtggcttcctgcccctggcactcccagatgtcgcgcccctc
actggccacgtctactctggcttcggcttccgcagcacccaggacagtggtctgctctac
cacagagcatccccggatgggccatgcagcgtgtccttgaagcagggccacgtgaccctc
cggtttgtgaggaccgaggtgaaatcgtcagggggctttgcggacggcgccccccattac
gtcgctttctacagcaacgccacaggggtctggctttacgtggacgaccagcttcagcag
acggtgccccaccgggggctgccctctaggccccggcccccgcccacggagcccccccag
ctcctcctgggaggcctgcctgagtcggacaccttccgtaacttcagtggctgcatcagc
aacgtttttgtgcagaggcttgaggggccccagcgtgtgtttgacctccagcagaacttg
gggggcatcagtgtgagctcaggctgtcccccggcccctggccccccgccatcacctgca
cctcaaggactacgggccacagcagctcggaaggcctcccggcgcagccggcagcccgcc
caggaccccgcctgcacaccacagcccctcgggatcatccagggcacctaccagtttggg
ggccccctgcccagttacctggagtttacaggcatcccagcgccccttagcaatcggtcc
cgcctcgcaatgctagtgcgcccccgctcccgaagcgggctcctggccctcgctgtgccc
ctgacatctggcagcccctccctgactctcttcctgagccacagctacttcgtggctcag
gcagcaggcggccctgtgccccagctcagggttcagagccgcctgcgttgtcaggcagac
cggtggcaccaggtgtctgtacggtgggacaacgctcgggtccagctgggggtgaacggg
gtctgggcccagagccgggagcagactgacaagcagcaccagggggctgaggccccccag
ccccacaccctctttgtggggggtcttcctctcggcagccagcacagccacaggctcccg
gtggctgtgagcagctcccggttcagcggctgtgtgaggagactgggactggacgggcgg
ctcctgaggaccccccacacgatgatgggggtcacgccctgcctctcagaacccctggag
cggggcctcttctttgctggtggcaggggagcccttactctagacaccctggggaccacc
ctgcctaacatgagcctgcagctggaggtgcggccccagacagccacaggcctcctcttc
cacctgggccagctccaggcgaccccctacctacaggcacaggtgctggggaagcaggtg
ctgctgagggcagacgatggagcaggcgccttctccacagctgtgacgctctccagggca
ctgtgtgacgggcagtggcaccagctggcagtgaccaaagacgggagtgccctgcagctg
gaggtggacgcccagagcagttggaccctgggtccagcgctggaggcctcagtgcacgcc
ccagcacccctgcacctcggcggcctgcccgaactcaaggacacacagaacgggcccccc
accctgccacacccatggcctccggtcttccagggctgcatgaggaacctgagggtgaac
gggtctttggtcaccctgcctcactctgtgcgtgtccagggcgcagtgggggccagcggc
tgcccaggcaggcggggtcctgcctccaggaaaacccgcccccccaaacagccagctaac
caggccacccttagccagtctcatagatga

KEGG   Desmodus rotundus (common vampire bat): 112306548
Entry
112306548         CDS       T05907                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112306548 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112306548 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112306548 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112306548 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112306548 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112306548 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112306548 (LAMC3)
   05145 Toxoplasmosis
    112306548 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 112306548
NCBI-ProteinID: XP_024418287
LinkDB
Position
Unknown
AA seq 1537 aa
MAGMKLYQDQPRFTDKTVRLQGYRPLAEPGAQCQRCDAADPLRHHNASYLTDFHSEDDTT
WWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYRRSCAGGPWEPYQ
YYSASCQKTYGRPEGQYLRPGQDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEE
SPLLQEWVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCHGHASECG
PDAAGQLVCRCQHNTTGVDCERCLPFFQDRPWARGTAEAANECLPCNCSGHSEQCVFDRE
LFRSTGHGGLCLHCRDHTAGPRCQHCQENFYRWNPSTPCQPCDCHPAGSLSLQCDDSGIC
TCKATVTGWKCDRCLPGFHSLSEGGCRPCTCHPAGSLGTCDPRSGRCPCKENVEGSLCDR
CRPGTFNLQPHNPAGCSSCFCYGHSKVCTAAAGFRVHGILSDFRQGAGGWRASSMGDPEH
PARWSPRGLPLDPDGEAELTAPEKFLGDQRFSYGQPLTLTFWVPPGGSPLPVELRLEGAG
LALTLPHSSLSGPPDTGQPGEVQLEFWLQETSEDVDPPLPPFHFQRLLANLTTLRIQTSP
SSSGQVFLTEVRLASAQRGLSPPASWVETCLCPKGYVGQFCESCAPGYKRETPLGGPYAS
CILCTCNQHGTCDPNTGICLCGHHTEGPSCERCLPGFYGNPFAGHADDCQPCPCPGQSPC
ATIPESGEVVCTHCPPGQRGRHCEICDDGFFGDPLGLSGDPQPCRRCQCSGNVDPNAVGN
CDPLSGHCLRCLHNTTGAHCERCQRGFYGSALALRAADKCAACSCNPGGSVSEQRPCDPV
TGQCSCLPHVTGRDCSHCSPGFYDLRPRKGCRSCKCHPLGSQENQCHPKTGQCPCRPGVQ
GRACNRCQLGFFGFSIKGCRACRCSSLGSASAQCHENSTCVCRPGFVGYKCDRCQDNFFL
TAGGAQCQECPSCYSLVKEEAAKLKARLALMEGWLQESDCGSPWGPMDILQGEAPRGDIY
QGHQLQGLREAFLVQVTGLKGAVKAAWEQLQALSGSARCGQARAGKTCLQLEDVEATLES
SEEEILHVAAVLASLVIPQEVPSQPTNWSHLATEARDLARSHKDTAAKIKAMARGALFTS
HTSYMLLWSLVEGRVALEAQRELEDRYQEVQAARKALDTAVAEVLPEAERALATMHQVGA
DTALHLTSMAVPAALPSISLHPQNSRTRDLGLKAQALKKMVISREPVVTEAARALQETAH
TMLHKTEPLTQLQREARAALTRASSSVQAARVTVVGARTLLADLEGVKLQFPRPKDQAVL
SRKAGIIRGRVLADVRKKTKQAEKMLGNAASVSSSAKKKGTEAALLAKNSAKLSKALLRA
GEQDRRRARRLSSQTLATLRQASQQVVASRAQLRELEEAEQVGAGLSEMGRQIRESRASL
EKDIRALSELLAGLGSLDTHQAPDQALNQTRLALEHLRLRLGPPGSLQGKLRLLEQESEQ
QELQIQSFESDLAEVRADKQNLEAILQSLPESCASWQ
NT seq 4614 nt   +upstreamnt  +downstreamnt
atggcgggaatgaagctgtatcaggaccaaccccgttttacagacaagaccgtgaggctc
caaggctacagacccctagcagagccaggggcgcagtgccaacgctgcgacgccgcggac
cccctgcgccaccacaacgcctcctacctcaccgacttccacagcgaggatgacactacc
tggtggcagagcccgtccatggccttcggcgtgcagtaccccacctccgtcaacatcact
ctgcgcctggggaaagcttacgagatcacctatgtgcggctgaagttccataccagccgc
cccgagagcttcgccatctacaggcgcagctgcgcgggcggcccatgggagccctaccag
tactacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgcccc
ggccaggacgagcgtgtggctttctgcacctccgagttcagcgacatctcccccctgagc
gggggtaacgtggccttctccaccctggagggccggcccagcgcctacaacttcgaggag
agccccctgctgcaggagtgggtcaccagcaccgagctcctcatctccctggaccggctc
aacacgtttggggacgacatcttcaaggacccgaaggtgctgcagtcctactactacgcc
gtgtctgacttctctgtgggcggcaggtgcaagtgtcacggacacgccagcgagtgtggc
ccagacgcggcaggccagctggtctgccggtgccagcacaacaccacgggcgtggactgc
gagcgctgcctgcccttcttccaggaccgcccgtgggcacggggcacagccgaggctgcc
aacgagtgtctgccttgcaactgcagcggccactcggagcagtgtgtgttcgaccgggag
ctcttccgaagcacgggccacggtgggctctgcctgcactgccgcgatcacacggccggg
ccgcgctgccagcactgccaggagaacttctatcgctggaacccatcgacaccctgccag
ccctgtgactgccacccggcaggctccctgagcctccaatgcgatgactcgggcatctgc
acctgcaaggccactgtgaccggctggaagtgtgaccgctgcctgccggggttccactcg
ctcagcgagggaggctgcagaccctgcacctgccatcccgctggcagcctaggcacctgt
gacccccgcagcgggcgctgcccctgcaaagagaacgtggaaggcagcctgtgcgacaga
tgccgcccggggaccttcaacctgcagcctcacaacccggccggctgcagcagctgcttc
tgctatggccactccaaggtgtgtacggccgctgccgggttccgggtgcacggcatcctc
tccgacttccgccagggagcaggtggctggcgggccagcagcatgggggacccagagcat
cctgcacggtggagccccagggggctccccctggacccagatggtgaggcagagctcaca
gcaccagagaagttcctgggtgaccagcggttcagctacgggcagcccctcacactgacc
ttctgggtcccccccgggggctccccgctccccgtggagctgaggctggaaggggcgggc
ctggccctgactctgccccactccagcctgtcaggccccccggacaccgggcagcccggg
gaggtacagctcgagttctggctgcaggagacctccgaggatgtggaccccccgctcccg
cctttccacttccagcggctgctggccaatctgaccactctgcgcatccagaccagccca
agctcctccggccaagtgttcctgactgaggtccgcctggcgtcggcccagcgggggctt
tccccgccggcctcctgggtggagacttgcttgtgccccaaggggtacgtgggccagttc
tgtgaatcctgtgctccagggtacaagagggagactcctctggggggtccctacgccagc
tgcattctctgcacctgtaatcagcatggcacctgtgaccctaacacagggatctgcctg
tgtggccaccacaccgagggcccatcctgtgagcgctgcttgccaggtttctatggcaac
cccttcgcaggccacgcggatgactgccagccttgtccgtgccccggacagtctccctgc
gcgaccatcccagagagtggggaggtggtgtgtacccactgccccccgggccagagaggg
cggcactgcgagatctgtgacgacggcttctttggggacccgctggggctctccggagac
cctcagccctgccggcggtgccagtgcagtgggaatgtggaccccaatgccgtgggcaac
tgcgaccccctgtctggccactgcctacgctgcctgcacaacacgacaggcgcccactgc
gagcgctgccagcggggcttctatggcagcgccctggccctgcgcgcggcagacaagtgc
gcggcctgcagctgcaacccagggggctcagtcagcgagcagagaccctgcgacccagtg
accggccagtgctcttgcctgcctcacgtgaccggacgggactgcagccactgcagccca
ggcttctacgacctccggcccaggaagggctgccggagctgcaagtgccacccgctgggc
tcccaggagaaccagtgccaccccaagactgggcagtgcccctgccgccctggcgtccag
ggccgggcctgcaacagatgccagctgggtttcttcggcttctccatcaagggctgccgg
gcctgcaggtgctcctccctgggctcagcctcggcccagtgccacgagaacagcacatgc
gtgtgcaggcctggcttcgtgggctacaagtgtgaccgctgccaggacaacttcttcctc
acggctggcggtgcacagtgccaggagtgcccgtcctgctacagcctggtgaaggaagag
gctgccaagctgaaggccaggctggccctgatggaggggtggcttcaggagtccgactgt
ggaagcccctgggggccaatggacattcttcagggagaggcccctcggggggacatctac
cagggccaccagctacaagggttacgggaagccttcctggtgcaggtgacaggcctcaag
ggtgccgtgaaggctgcctgggagcagctgcaggcgctgagcgggagtgcccgctgtggc
caggccagagctgggaagacctgcctccagctggaagacgtggaggcgaccctggagtcc
tcagaggaggagattctgcatgtggccgccgtcctagcatctctggtaatccctcaggaa
gtccccagccagcccaccaactggagccacctggccacagaggcccgtgaccttgccagg
agccacaaggacaccgccgccaagatcaaggccatggctcggggggctctgttcacctcc
cacaccagttacatgcttctctggagtctggtggagggcagagtggccctggaggctcag
cgggagctggaggacaggtaccaggaggttcaggcggcccggaaggcactggacacagct
gtggcggaggtgctgcccgaagctgagcgggcgctggccaccatgcatcaagtcggggct
gacacagccctgcacctgacctcgatggctgtccctgcagcactgccctccatctctctg
catcctcagaattccaggaccagggacctaggcctgaaggcacaggccctgaagaagatg
gtcatttccagggagcctgtggtcaccgaggctgcccgggccctccaggagactgcccac
accatgctgcacaagacagagcccctcacacagctgcaacgtgaggccagagctgccctg
acccgggcgtcctcgtccgtccaggctgccagagtgaccgtcgtgggagccaggaccctg
ctggctgacctggaaggagtgaagctgcagtttcctcggcccaaggaccaggctgtgctg
agcaggaaggcaggcatcatccggggcagggtccttgcagacgtgagaaagaagaccaag
caggcggagaagatgctgggaaacgcggcatcggtctcctccagtgccaagaaaaaaggc
acagaggccgcgctgttggccaagaacagtgccaagctctccaaggccttgctgagggct
ggggagcaggatcgccgccgtgccaggcggctctccagccagacgctggcaaccctgcga
caggcctcccagcaggtggtagcctcaagggcgcagctacgggagctggaggaagctgag
caggtgggtgccgggctgagcgagatggggcggcagatccgggaatcgcgtgcctccctg
gagaaggacatcagggccttgtcggagctgcttgccgggttggggtcgctggacacccat
caagccccagaccaggccctgaaccagaccaggctggcactggagcacctgaggctacgg
ctgggcccgcccgggtccctgcaggggaaactgaggctgttggagcaggagtcggagcag
caggagctgcagatccagagcttcgagagtgaccttgccgaggtccgtgctgacaagcag
aacttggaggccattctgcaaagtctgcctgagagctgcgccagctggcagtga

KEGG   Desmodus rotundus (common vampire bat): 112307731
Entry
112307731         CDS       T05907                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04974  Protein digestion and absorption
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112307731 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112307731 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112307731 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112307731 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    112307731 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307731 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112307731 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112307731 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112307731 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112307731 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112307731 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112307731 (COL4A3)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112307731 (COL4A3)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112307731 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112307731
NCBI-ProteinID: XP_024419626
LinkDB
Position
Unknown
AA seq 1675 aa
MCPRTARKLPALLLPLLLVLLLVLLATVPAAGKGCVCKDKGRCFCDGTKGEKGEKGFPGP
PGSPGQKGFPGPEGSPGPQGPKGSRGLPGPTGPKGVRGITGLPGFSGPPGLPGNPGYPGP
YGLPGLPGCNGSKGERGFPGFPGTPGYPGVPGAPGSKGEKGAPAEGEDVELDGKGDPGLP
GAPGLQGWPGLPGFPGPVGPPGPPGFFGLPGAMGPPGLKGHMGDNVVGQKGERGLKGLRG
PPGPPGTVTVTLTGPDNRTDLKGEKGDKGDQGRAGPPGPSGPPGDSYGSEKGARGEPGPQ
GKPGKDGAPGLPGTEGAKGSRGLPGLAGEDGIKGRKGDIGPPGFRGPTEYYDAYQKKGDE
GIPGPPGRKGARGPPGPSGPPGEPGRPGSSKPGLRGASGPPGMKGRKGEPGPPGKNTVGL
PGSPGCPGTPGPPGPPGPPGPPGGIIFLKGLPGEVGRPGPVGPPGIPGVNGRKGEPGLLC
TECPYVPGPPGLPGLPGLDGMKGVPGGQGAPGIKGSPGSPGSAGLPGSPGFPGAQGDPGL
KGEKGEAPQPVGQVGDPGDAGPRGQPGLRGLDGTPGTPGVKGSPGPKGEPALYGVKGDRG
PPGDPGIPGPPGPTGPAGPPGYGPRGEPGPKGTQGVPGARGPPGEAGPKGEAGVSTPVPG
PPGPPGPPGRAGPQGPPGFPGPKGRYGDPGVPGPDGDPGIPGIGFPGPPGPKGDRGFPGR
KGLPGRPGEVGKPGLPGEPGPPGAKGEPGLAMPGEPGTPGFPGERGNSGENGEIGLPGFP
GPPGIPGTGGLDGPRGDPGQPGPPGEKGLPGRCIQGPKGDPGLPGLNGLKGQEGRKGETG
LKGDPGIPGMDRSGFPGEPGLPGMPGHRGEMGPPGQKGYPGNPGFLGPPGERGMVGMMGF
PGSIGLPGPPGSPGPPGQRGSLGIPGAKGERGPPGAKGDKGTKGPPGPSQILSFLGDKGE
PGLKGFAGKLGEKGDRGIPGLPGREGFKGPPGPPGPPGPLGDPGSPGNPGEAGPRGLPGS
MGNMGLPGPKGEMGTLGLPGLPGRPGLPGTHGLQGDKGEPGYSEGTRPGPPGPKGEPGLP
GDMGKKGERGPPGSPGYPGPAGPDGAPGHPGSPGPPGDPGADGELGSKGVKGFPGCPGTK
GPPGPPGFPGDPGPMGMRGDQGRDGIPGPTGEKGETGLLGALPGPKGRPGAPGAKGDRGA
PGLPGLPGRKGMVGDVGPPGPTGMAGFPGPPGKPGAILPGQKGNRGPPGSRGNPGEPGPP
GPPGRHVEGLKGEKGSMGKPGPRGPPGTAGDAGPLGPPGAPGTPGLPGLRGDPGFPGFPG
MKGEKGNPGLLGSIGPPGQMGPKGPPGVRGDPGTITIISLPGSPGPPGPAGRPGTQGEPG
PPGPPGKPGPCGPRGKPGKDGNPGTPGPPGEKGNKGRKGEQGPPGFDGLPGLKGKPGDTG
PPATGPTTRGFIFTRHSQTTAIPSCPDGTEPLYSGYSLLFVQGNEQAHGQDLGTLGSCLQ
RFTTMPFLFCNINDVCNFASRNDYSYWLSTAALMPMDMAPITGRALEPYISRCTVCEGPA
MAIAIHSQTTDTPSCPHGWMSLWEGFSFVMFTSAGSEGAGQALASPGSCLEEFRASPFIE
CHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCRVCMKRRQ
NT seq 5028 nt   +upstreamnt  +downstreamnt
atgtgcccccggacggcgcggaagctgcccgcgctcctgctgccgctcttgctggtgctt
ttgctggtgcttttggcgaccgtgcccgccgcgggcaagggttgtgtctgtaaggacaaa
ggccggtgcttctgtgatgggaccaaaggggagaagggggagaaaggttttcccggaccc
cctgggtctcctggccagaagggattcccaggtcccgaaggctcacctggaccacaggga
cccaagggctctcgaggacttccaggccccactggtcccaaaggtgtcaggggaataact
ggattaccaggattttcagggcctcctggacttccaggcaacccaggctatcctggaccg
tatggcctcccgggtttaccaggatgcaatggctccaagggcgagcgagggtttccggga
tttccagggacaccaggctacccaggggtaccgggtgctcctggttcaaaaggagaaaag
ggtgctcctgcagaaggagaagatgtagaacttgatggaaaaggtgaccccggcttgcca
ggagccccaggattacagggttggccgggacttcccggttttcccggaccggttggccca
cctggccctccaggattctttggcttgccaggagccatggggcctccaggacttaagggt
cacatgggtgataacgtggtcggacaaaaaggagagcggggtctgaaaggattacgagga
cccccgggaccaccaggcactgtgacagtgacactgacgggcccagacaacaggacggac
ctcaagggggagaagggagacaagggagaccagggcagagccgggcctcctggaccctcg
ggaccacctggagactcttatggatcggaaaaaggtgcccgtggagaacctggcccacag
gggaaacccggaaaagacggcgcccctgggctccctggcactgagggagccaaaggcagc
aggggcttgcctgggttagcgggtgaagacggcattaaggggcggaaaggggacatcggc
cctccgggatttcgtggtccaacagaatattatgatgcataccagaaaaagggagatgag
gggattccaggcccaccagggcgcaaaggagctcgtggcccaccgggtcccagtggccct
cccggagaacctggaaggcctgggtcatcaaaacctggcctcagaggagcctcgggacca
ccaggcatgaaaggaagaaaaggggagccaggacccccagggaagaatacagtggggctt
cccgggtccccgggttgtcctggtacaccaggcccaccggggccgccgggacccccagga
ccaccaggtggcatcattttcctcaaaggcctacctggggaagttggacgtcccggccca
gtggggcctccaggaatcccaggggtcaatgggcgcaaaggggaaccaggcctcttgtgc
accgaatgtccttatgtcccagggcctccgggcctcccaggactgccggggttagatggc
atgaaaggagtcccaggaggacaaggagcacctggcattaaaggaagcccaggttcccca
ggaagtgcgggtctcccaggatctccaggattcccgggtgctcaaggtgacccaggactt
aaaggagaaaaaggtgaagcgccccagccagttggacaagtaggtgaccccggggatgca
gggcccagagggcagcctggactaaggggcttggatggcactcctgggacccctggagta
aaaggatcaccaggacctaaaggcgaaccggccctctatggtgtaaagggggaccggggt
cctccaggggatcctggcatccctgggcccccaggacccacaggaccagctggcccacca
ggctatggacctcggggagagcctggtccgaaaggcacccaaggagttcctggagcccgt
gggccacctggagaagccggccctaagggagaagctggtgtttcaactccggtccctgga
cccccaggacctccagggcccccaggccgtgccggcccccagggtccacctggtttccct
ggacccaaaggacgatatggtgacccaggagttcctgggcctgacggtgatccaggaatt
ccaggaattggattccctgggcctcctggacccaagggagaccgaggttttccaggaaga
aaagggttaccaggtcgtccaggagaagtgggaaagccggggctaccaggagagccaggg
cccccaggagccaagggagaaccaggactagccatgcctggagaaccaggaacaccaggt
tttccaggagaaagaggcaattcgggggaaaatggagaaattggactccctggatttcca
ggtccccctggaattccaggaactggagggcttgatggaccacgaggggatccagggcag
cctggacctcctggagaaaaaggactcccaggaagatgcatacagggtcccaagggagac
ccaggacttccaggcttaaatggattgaaagggcaagaaggcagaaaaggcgaaacagga
ctaaaaggagacccagggattccgggcatggataggtcaggatttcctggagaacctgga
ctaccaggaatgcccggtcatcgaggtgagatgggaccacctggtcaaaaaggatatccg
ggaaatccaggatttttagggccaccaggtgaaagaggaatggttgggatgatgggtttt
cctggcagcattggcctccccgggcctcctgggagcccaggccctccaggacagaggggt
agccttggaattccaggagcaaagggtgagagaggacccccaggagccaagggggacaaa
ggcactaaaggaccccctgggccttctcagatactctccttcctgggggacaaaggagaa
ccaggcctcaaaggattcgcaggaaagctgggtgagaaaggagacagaggcatcccagga
ttaccgggccgggaaggattcaaagggccacctgggccaccaggaccaccaggccccctc
ggagatcctggaagccctgggaatcctggagaagcaggaccccgtggcctgccaggaagc
atgggcaacatggggttgccagggcccaaaggagagatgggaaccctgggactcccaggt
ctacctggaagaccaggcctcccaggtactcatggtctccaaggagataagggagagcca
ggttattcagaaggtacaaggccaggaccaccaggaccaaagggagaaccaggattgcca
ggtgatatgggaaagaaaggagaaagagggccgcctggctcacccggatacccagggcct
gctggacctgatggagcccctggacatcccggaagccctggacccccaggagacccgggt
gcggatggtgaactggggtctaaaggcgtgaaaggcttccctggatgtccaggcaccaaa
ggccctccagggcccccagggttcccaggagaccctggaccaatggggatgagaggtgac
caaggacgtgatggaattcccggtccaacaggagaaaagggagaaacaggtctgctgggg
gcacttccaggccccaaagggagacctggagctccaggagccaaaggagacagaggggcc
ccaggcttgcccggcctccccggcaggaaagggatggtgggcgatgttgggccgccagga
cccacgggaatggcaggattcccagggccgccagggaaacctggtgcaatcctccctggc
cagaaaggaaaccgaggtcccccaggctcaagaggaaacccaggtgagcctggtccaccc
gggcctccagggagacacgtggaaggcttgaaaggagagaaggggtctatgggcaagcct
ggcccgagaggcccaccgggaactgcaggagacgctgggccactgggtcctccgggagca
ccaggaactccaggcctgccagggctcagaggtgatcctgggttcccaggatttccaggc
atgaaaggagagaaaggtaatccaggacttctgggatcaatcggacctccagggcaaatg
gggccaaaaggaccaccaggtgtacgtggagaccctggcacaatcaccatcatctccctt
ccaggaagtccagggccaccgggcccagctggacgaccagggacacaaggagaacctggg
ccaccagggccaccggggaaaccaggaccctgtgggccaagaggtaaaccaggcaaggat
ggaaacccaggaactcccgggccacctggagaaaaaggcaacaaaggtcgtaaaggagag
caaggaccacctggattcgatggactgccgggtctgaaggggaagccaggcgacactgga
ccacctgcaaccggccccacaacgagaggctttattttcacccggcacagtcagaccaca
gcaattccttcctgtccagacggaacagagccgctctacagcgggtactctcttcttttc
gtacagggcaacgaacaagctcatggacaagacctgggaactcttggaagctgcctacag
cgatttaccacaatgccattcttattctgtaacatcaacgatgtatgtaacttcgcatct
cgaaatgattattcatactggctgtcaacagcagctctgatgccaatggacatggctcca
attactggcagagccctggagccttatattagcagatgcaccgtctgtgagggccctgca
atggccatagccattcacagccaaaccactgacactccctcatgtccccatggctggatg
tctctttgggaaggattttccttcgtcatgttcacaagtgcaggttctgagggcgctggg
caagcactggcatcccctggatcctgcttggaagaattccgagccagtccatttatagaa
tgtcatggaagaggaacatgcaactactattcaaattcctacagtttctggttggcttca
ttaaacccagaaaggatgttcagaaaacctattccatcaactgtgaaagctggggagtta
gaaaagataataagtcgttgtcgggtgtgcatgaagagaagacaatga

KEGG   Desmodus rotundus (common vampire bat): 112307828
Entry
112307828         CDS       T05907                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04810  Regulation of actin cytoskeleton
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05100  Bacterial invasion of epithelial cells
dro05135  Yersinia infection
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112307828 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112307828 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112307828 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112307828 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307828 (FN1)
   05205 Proteoglycans in cancer
    112307828 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112307828 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112307828 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112307828 (FN1)
   05100 Bacterial invasion of epithelial cells
    112307828 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112307828 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112307828 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112307828 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112307828 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112307828 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:dro04990]
    112307828 (FN1)
Membrane trafficking [BR:dro04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    112307828 (FN1)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   112307828 (FN1)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112307828 (FN1)
Domain-containing proteins not elsewhere classified [BR:dro04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   112307828 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 112307828
NCBI-ProteinID: XP_024419776
LinkDB
Position
Unknown
AA seq 2289 aa
MLRGPGLGLQLLLAVLSLGTAVSAWRGKRQAQQMIQTPSLVPVSQSKPGCFDNGNHYQIN
QQWERTYLGNTLVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWD
CTCIGAGRRRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
AEKCFDHAGGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRI
GDTWSKKDNRGNLLQCICTGNGRGEWKCERHASVQTTSTRSGTVTDVQMAVFQPHTNPQP
VPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVL
PFTYNGRTYYSCTSEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLIQTRGGNSNGALCHF
PFLFNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTKEGVMYRIGD
QWDKQHDMGHMMRCTCVGNGRGEWTCVAYSRLRDQCIVDDITYNVNDTFHKRHEEGHMLN
CTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPL
QTYPGTSGPVQVIITETPSHPNSHPIQWNAPEPSHISKYILRWKPKNSPNWKEATIPGHL
NSYTIKGLRPNVVYEGQLISVQQYGHREVTRFDFTTTSTNPAMSSNTVTGETTPFSPVVA
TSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPG
RKYIVNVYQISEEGEQSLILSTSQTTAPDAPPNPTVGQVDDTSIVVHWSRPQAPITGYRI
VYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGVPR
PDKVPPPRDLQFVEVTDVKITIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPVSRNNFAE
VLGLSPGVTYHFKVFAVNHGRESKPLVGEQTTKLDAPTNLQFMNETDSSVIVTWTPPRAR
IAGYRLTVGLTRGGQPKQYNVGPSASQYPLRNLQPGSEYTTTLVAVKGNQQSPRATGVFT
TLQPRGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGL
TPGVEYVYTISVLRDGQERGAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDI
TGYRITTTPTNDQQGYSLEEMVRADQSSCTFENLNPGLEYNVSVYTVKDNKESVPISDTI
IPAVPAPTDLRFTNVGPDTIRVTWAPPPSIELTGILVRYSPVKNEEDVAELSISPSDNAV
VLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRA
TITGYRIRHHPEHTGGRPREDRVPPTRNSITLSNLNPGTEYVVSIVALNGREESPPLVGQ
QSTVSDVPRDLEVVATTPTSMLISWEAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTA
TISGLKPGVDYTITVYAVTGRGDSPASSKPVSIDYRTEIDKPSQMQVTDVQDNSISVRWL
PSSSPVTGYRVTTTPKNGLGPTKTKTAGPDQTEMTIEGLQPTMEYVVSVYAQNQNGESQP
LVQTAVTTIPAPTNLKFIQVTPTSLTAQWTAPNIQLTGYRVRVTPKEKTGPMKEINLSPD
SSSVVVSGLMVATKYEVSVYALKDTLTSMPASGVVNTLENVSPPRRARVTDATETTITIS
WRTKTETITGFQVEAMPANGQTPIQRTISPDVRSYTITGLQPGTDYKIYLYTLNDNARSS
PVIIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRP
GVTEASITGLEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLQGPEILDV
PSTAQKTPSITNPDYGTGFQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPVRHRPGP
YPPNVNEEIQIGHVPRGDVDHHYYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIIS
CHPVGTDEEPLQFRVPGTSASATLTGLTRGTTYNIIVEALKDHQRHKVQEKVVTVGNSGP
NTLTDDSCFDPYTVSHYAVGEEWERLSDSGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNF
KIGEKWDRKGENGQMMSCTCLGNGKGEFKCDPHETTCYDDGKTYHVGEQWQKEYLGAICS
CTCFGGQRGWRCDNCRRPGAEPGHEGTPGHPYSNPYSERYHQNSNTNVNCPIECFMPLDV
QADIDDSRE
NT seq 6870 nt   +upstreamnt  +downstreamnt
atgctcaggggtccggggctcgggctgcagctgctgctggccgtcttgtccctggggaca
gcggtgtccgcctggaggggcaagagacaggctcagcaaatgattcagaccccgtccctg
gtgcctgtcagccaaagcaagcctggttgttttgacaatgggaatcactatcagataaac
caacaatgggaacgcacgtacctgggcaataccttggtttgtacctgttatggagggagc
cgaggctttaactgcgagagtaaacccgaagctgaagagacttgctttgacaagtacact
gggaacacttaccgggtaggggacacttatgagcgccctaaagactccatgatctgggac
tgtacctgcattggggctgggcgaagaagaataagctgtaccattgcaaaccgctgccat
gaagggggtcagtcctacaagatcggtgacacctggagaaggccacatgagacgggtggc
tacatgctagagtgtgtatgtcttggtaacgggaaaggagaatggacctgcaagcccata
gctgagaagtgttttgaccatgcgggtgggacttcctacgttgtcggggaaacctgggaa
aagccctatcaaggctggatgatggtggattgcacttgtctgggagaaggcagtggacgc
atcacctgtacctctagaaacagatgcaacgaccaggacactaggacgtcctacagaatc
ggggacacctggagcaagaaggacaatcgggggaacctgctgcagtgcatctgcacgggc
aacggccgaggggaatggaagtgtgaacggcacgcgtccgtgcagaccacctccaccaga
tctggcactgtcacagatgttcaaatggccgttttccagcctcataccaacccccagcct
gtcccctatggtcactgtgtcaccgacagtggtgtggtttactcggtggggatgcagtgg
ctgaagacacaaggaaataagcagatgctttgcacttgcctgggcaatggagtcagctgc
caagagacagctgtaacacaaacttacggtggcaattcgaacggggagccatgtgtctta
ccgttcacctacaacggcaggacttactactcctgcaccagtgaggggcgacaggatggc
catctctggtgcagcaccacttccaattatgaacaagaccagaaatactctttctgtaca
gaccacactgtgctgattcaaactcgaggtggaaattccaatggtgccttgtgccacttc
cccttcctattcaacaaccacaactacactgactgtacttctgagggcaggagagacaac
atgaaatggtgtggaaccacacagaactatgacgccgaccagaagttcggattctgcccc
atggctgcccatgaagaaatctgtacaaccaaagaaggcgtcatgtatcgcattggagac
cagtgggataaacagcatgacatggggcacatgatgaggtgcacatgcgtggggaatggc
cgtggggagtggacctgtgttgcctactcccggctccgagatcaatgcattgtcgacgac
attacttacaacgtgaacgacacatttcacaagcgtcatgaagagggacacatgctgaat
tgcacctgttttggccagggccggggtagatggaagtgtgaccccatcgaccagtgccaa
gactcagaaacccgaacattttatcaaattggagactcctgggagaagtatgtgcatggc
gtcaggtaccagtgctactgctatggccgtggcattggggagtggcattgccagccctta
cagacctatccaggcacttccggtcctgtccaagtcatcatcacagagacccccagccac
cccaactcgcaccccatccagtggaatgcaccagaaccctcccacatttccaagtacatc
ctcaggtggaagcctaaaaactcgcccaattggaaggaagccaccattccaggccactta
aactcctacactattaaaggcctgaggccaaatgtggtatatgaggggcagctcataagt
gtccagcaatatggccacagagaagtgactcgctttgacttcaccaccaccagcacgaac
ccagcaatgagcagcaacacagtgacgggagagacaacacccttttctcctgtggtggcc
acttctgaatctgtgactgaaatcacggccagtagctttgtggtctcatgggtctctgct
tcggacacggtgtcaggattccgtgtggaatatgagctgagtgaagagggggatgagcct
cagtacctcgatcttccaagcacagccacttctgtgaatatccctgacctgctgcctggc
cgaaaatacattgtaaatgtctatcagatatctgaagaaggagagcagagtctgatcctg
tctacttctcagacaacagcacccgatgcccctcctaatcctaccgtgggccaagttgat
gacacgtcaatagtggttcactggagccgaccccaggcccccatcacagggtacagaatc
gtgtattcaccatcagtcgaaggcagtagcacagaactcaaccttcctgaaactgccaac
tctgtcaccctcagcgacttgcaacccggtgttcagtataacatcactatctacgctgtg
gaggaaaaccaagagagcactcccgtcttcatccagcaggaaaccaccggcgtccctcga
ccggataaagttccccctccccgggacctgcagtttgtggaagtgacagacgtgaagatc
accatcatgtggacaccccccgagagtgccgtgaccggttaccgcgtggacgtgatcccc
gtcaacctgcctggagagcacgggcagcggctgcccgtcagcaggaacaactttgcggaa
gtcttagggctgtccccgggggtcacctaccacttcaaggtctttgctgtgaaccacggg
agggagagcaagcctctagtaggagaacagaccaccaaattggatgctcccactaacctc
cagtttatgaatgaaacggactcaagcgtgatagtgacctggactccccctcgagcccgg
atagctgggtaccggctgaccgtgggcctgacccggggaggccagcccaagcagtacaac
gtggggccctccgcctcacagtacccgctgaggaatctgcagccggggtccgagtacacc
accaccctcgtggctgtgaaaggcaaccagcagagccccagggccactggggtattcacc
actctgcagcccaggggctccatcccaccttacaacacggaggtgacggagaccaccatt
gtgattacgtggacgcctgctccaaggatcggttttaagctgggtgtacggccaagccag
ggaggggaagccccacgagaagtgacttcagactcgggaagcattgttgtgtcgggcctg
actccgggcgtggagtacgtgtacaccatctcagtcctcagagatgggcaggagagaggt
gcacccattgtcaacagagtggtgacacccttgtctccaccaaccaacttgcacctggag
gcaaaccctgacaccggagtgcttacggtctcctgggaaaggagcaccactccagacatt
actgggtatagaattaccaccactccaacaaatgaccagcagggatattctctggaagaa
atggtccgtgcagatcagagttcctgcacttttgaaaacctgaatcctggcctggagtac
aatgtcagtgtttatactgtcaaagataacaaggaaagtgtccctatctctgataccatc
atcccagctgtgcctgcccccactgacctgcgattcaccaacgtcggtccagacaccatt
cgtgtcacctgggccccacctccatccatcgagttgaccggcatcctggtgcgctactca
cctgtgaaaaatgaggaagatgttgcggagttgtcgatttctccgtcggacaatgcagtc
gtcttaacaaatctgctgcccggcacggaatacgtagtcagcgtctctagtgtttacgaa
cagcacgagagcacgcctctcagaggaagacagaaaacaggtctcgattccccaactggc
attgacttttctgatatcactgccaactctttcactgtccattggatcgctcctcgggcc
accatcactggctaccggattcgccaccatcctgagcacacaggtggaagacctcgagaa
gatcgagtgccccccactcggaattccatcaccctcagcaacctcaacccgggcacggaa
tatgtggtcagcattgttgcacttaatggcagagaggaaagtcccccattggttggccag
caatcaacagtttctgatgttccgagggacctggaagttgttgccacgacccccaccagc
atgttgatcagctgggaagcccctgctgtcacagtgagatattacaggatcacctatgga
gagacaggaggaaatagccctgtgcaggagttcactgtgcctgggagcaagtctacagct
accatcagtggccttaaacctggagtggactacaccatcactgtttacgctgtcactggc
cgaggggacagcccagcaagcagcaagccagtttccattgattaccgaacagaaattgac
aagccatcccagatgcaagtgactgatgttcaggacaacagcatcagtgtcaggtggctg
ccgtcgagttcccctgttactgggtacagagtgaccaccacgcccaaaaatggcttggga
ccaacaaaaaccaaaactgcaggtccagatcaaacagaaatgaccatcgaaggcttgcag
cccacaatggagtatgtggttagtgtctatgctcagaatcaaaacggagagagtcagcct
ctggtccagactgcggtaaccaccattcctgcaccaaccaacctgaagttcattcaggtt
acaccaacgagcctgactgcccagtggacagcacccaacattcagctcactggctatcgg
gtgcgggtgacccccaaagagaagacaggaccgatgaaagaaatcaacctttctcctgat
agctcatctgtggttgtatcaggactcatggtggccaccaaatatgaagtgagtgtctat
gctcttaaggacacgttgacaagcatgccagcttctggagttgtcaatactctggagaat
gtcagccctcccagaagggcccgtgtgaccgatgccactgagaccaccatcaccattagc
tggagaaccaagactgagacgatcactggcttccaggtggaagccatgccggcaaatggc
cagactcccattcagagaaccatcagtccagatgtcagaagctacaccatcacaggttta
caacccggcactgactacaagatctacttgtacactttgaacgacaatgcccggagctcc
cctgtcatcatcgacgcctccactgccatcgatgcaccatccaacctgcgattcctggcc
accacacccaactccttgctggtgtcatggcagccgccacgggccaggatcactggttac
atcatcaagtatgagaagcctgggtcccctcccagagaagtggtccctcggccccgccct
ggtgtcactgaggcttctattactggtctggaaccaggaaccgagtacacaatccaagtc
attgcccttaagaacaaccagaagagtgagcctctgatcgggaggaaaaagacagatgag
cttccccaactggtaacccttccacaccccaaccttcaaggaccagagatcttggatgtt
ccctccacagctcaaaagaccccttccatcaccaaccctgactatggcaccggttttcag
cttcctggcacttcgggtcagcagcccagtgttgggcaacaaatgatctttgaggagcat
ggttttaggcggaccacgcctcccaccacggccacccctgtaaggcataggccaggacca
tatccaccgaatgtaaatgaggagatccaaattggccatgtccccaggggagacgtagac
catcactactaccctcacgttccgggactcaatccaaatgcttctacaggacaagaagct
ctctctcagacaaccatctcttggaccccgttccaggaaagctctgagtatataatttca
tgtcatcccgttggcactgatgaagagcccttacagttccgagttcctggaacttctgct
agcgccacactgacgggtctaaccagagggaccacctataacatcattgtggaagcactg
aaagaccaccagcggcacaaagttcaggaaaaggttgtcactgtgggcaactcgggcccc
aacacgctgacggatgactcgtgcttcgacccctacacggtttcgcattatgccgttgga
gaggagtgggagcgattgtccgattcgggctttaaactctcgtgccagtgcttaggcttt
ggcagtggtcatttcagatgtgattcatctaaatggtgccacgacaatggcgtcaatttc
aagattggagagaagtgggatcgtaagggagaaaatggccagatgatgagctgcacgtgc
cttggaaatggaaaaggagaattcaagtgtgatccccatgaaaccacatgctatgatgat
gggaagacgtaccacgtaggagaacagtggcagaaggaatatctcggtgctatttgctcc
tgcacttgctttggaggccagcggggctggcgctgtgacaactgccgcagaccaggggct
gagcccggtcacgaaggcactcccggtcacccctacagcaacccgtactctgagaggtac
catcagaactcaaacactaatgtcaactgccccattgagtgcttcatgcccttagatgta
caggctgacatagacgattctcgggagtaa

KEGG   Desmodus rotundus (common vampire bat): 112307910
Entry
112307910         CDS       T05907                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04974  Protein digestion and absorption
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112307910 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112307910 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112307910 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112307910 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    112307910 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307910 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112307910 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112307910 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112307910 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112307910 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112307910 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112307910 (COL4A4)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112307910 (COL4A4)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112307910 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112307910
NCBI-ProteinID: XP_024419851
LinkDB
Position
Unknown
AA seq 1686 aa
MELVRRASRWIEPLATNPWSLILIVFSMQHAYGSGKKFPGPCGGRDCFVCQCFPEKGSRG
QPGPPGPQGPIGLPGPPGPIGIPGEKGMRGDSGPPGAAGERGDKGPIGLPGPPGPIGIPG
HPGPPGPRGKPGLNGFNGSRGDPGFPGERGAPGLEGPPGLPGEIGEKGNSVFIFGAIKGI
QGDRGDPGPPGLPGPRGARGPAGPMGYPGEPGLPGPPGHPGSPGVKGNPGVGVKGQMGDP
GEVGQQGSPGPTLLVQPPDSSLYKGEKGVKGMPGMIGLPGPPGPKGEPGVGEKGEKGIPG
FPGPRGEPGSYGSPGFPGLKGEKGYPGSPGPSGLPGPKGDTGDRGPPGPSGILMTPPPPF
KGPPGDPGLPGRHGEMGAVGLPGPPGPPGLPGETCPGIMGLPGPPGFPGHPGVVGAAGVP
GRPDLAPGKPGHPGPPGLPGAPGRQGPPGSDVIYCSVGHPGPQGVKGKMGPPGRRGSKGE
KGNAGPCACKPGPMGSPGLPGLPGRQGSKGDLGPLGWPGEKGHPGPPGAEGSPGPPGAPG
APGPPGDKGEKGDRVVARVKGHKGERGPDGLPGLPGQRGQHGWDGHPGAPGDPGPPGDHE
DAAPGDRGFPGQPGSPGREGPRGPPGLGFPGPPGERGQPGAPGHLGERGPDGPKGQKGDT
ISYNVSYPGKPGPPGADGPPGPRGFPGPRGAPGLRGFDGQKGWPGKPGISEIPGPPGVRG
VTGDPGLEGDKGSSPAGPPGPPGLPGPDGQKGIPGDPSYGYPGPPGKRGPSGMPGLKGLR
GDPGHPGPAGPAGMPGIPGLKGPKGREGSAGFPGIPGPPGHSCERGAPGIPGPPGLPGAP
GSPGAPGWKGQRGDAGPPGPAGMKGLPGVPGRPGVDGPPGPPGIPGPFGDDGLPGVPGPK
GPQGLPGLPGFPGERGKPGPEGHRGRKGDIGEKGWPGFQGDQGVRGAKGDTGSPGDEGEM
TIISKTGATGDTGPPGDDGPPGEEGDKGYPGMPGRRGDPGRPGPPGLHRGEPGENGRPGL
PGPPGPPGFPGPRGIIGFPGFPGDQGEPGIPGPPGPSGLDGMRGPKGDKGGPASQFGPPG
PKGEPGSPGCPGHLGAPGEKGLPGAEGPRGPPGRPGLPGFPGPQGCPGHPGRPGPMGPPG
EMGDPGPSGPIGHPGPPGLPGIKGPSGLPGLNGLHGLKGQKGAKGASGLYEMGPPGPMGM
PGLKGETGDPGSPGISPPGLFGEKGPPGPPGRPGPPGPAGAPGRAPTGDIPDPGPPGDQG
PPGPDGPQGPPGPPGPPGTAYLVPGEPGDYGLPGPPGPPGPAGPPGRKGYPGCDGEDGRK
GPMGFPGPQGPHGLPGSPGEKGLPGPPGRQGPPGPPGPRGEPGPPADLDACPRVPGLPGV
PGPRGPEGAMGLPGMRGPPGAGCKGEPGLAGRRGEDGIPGPPGPPGHKGDMGEAGFPGAP
GPPGPTGDPGPRGFGPGYLSGFLLVLHSQTDGEPTCPMGMPRLWTGYSLLYLEGQERAHN
QDLGLAGSCLPVFSTLPFAYCNIHQVCHYARRNDRSYWLASTAPLPMAPLSEEDIRPYIS
RCAVCEAPAQAVALHSQNQSIPPCPRAWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLE
DFRAAPFLECQGRQGTCHFFANKYSFWLTVVKPHLQFAEAPSPDTLKDSQAQRQKISRCQ
VCVKVS
NT seq 5061 nt   +upstreamnt  +downstreamnt
atggagttggtgaggcgcgcttccaggtggatcgagcccttggccacaaacccctggtca
cttatccttattgtcttttctatgcaacatgcatatgggagcggaaagaagttccctggt
ccttgtggaggaagagattgctttgtttgccagtgctttcctgagaaggggtctcgggga
caaccaggaccaccagggccccagggtcctattggactgccgggacctccaggacccatt
gggattccaggagagaaagggatgagaggggacagtggccctcctggagcagcaggtgaa
agaggagataagggtcctattggactgccgggacctccaggacccattgggattccgggg
cacccagggcctcccggacccagaggcaaacctggcttgaatggcttcaacggatcaaga
ggtgatccagggtttccaggagaaagaggagctcctggcctggaaggccccccaggtctt
cctggggaaattggagaaaaaggaaattccgtgttcatttttggtgccatcaaaggtatt
cagggtgacagaggggacccaggacctcccggcctcccaggaccaaggggtgctagagga
ccagcaggccccatgggatacccaggagagccggggttaccaggacctccgggccatcca
gggagtccaggtgtgaagggtaatcctggcgtgggagtaaaagggcaaatgggagacccg
ggtgaggttggccaacaaggttctcctggaccgaccctactggtacagcccccggattct
agtctctataaaggagaaaagggtgtgaaagggatgccggggatgattggacttccggga
cctccaggacccaagggagaacctggtgttggggaaaaaggagaaaagggcattcccggc
ttcccaggccctcggggtgagcccggctcctatggatctccaggttttccaggattaaag
ggggaaaaagggtatcctggaagccccgggccatctggacttcctggcccaaagggggat
actggagatcgtgggcccccaggaccatcagggattttgatgacgccacctcctccattc
aaaggccctccgggagatccaggcctccctggccgccatggagaaatgggggctgttggg
ctccctggtccccccggccccccaggtctaccaggggaaacctgtccaggcataatggga
ctccccgggccgccggggtttcccggtcatcccggagttgtgggggcagcaggtgttcct
gggagacctgatttggctccagggaaaccggggcacccggggccacctgggttgcccgga
gcaccaggacgtcaggggcctccgggatcagatgttatatattgtagtgttgggcaccct
ggaccacaaggagtaaaaggcaaaatgggtcctcccggaagaagaggctcaaaaggagaa
aaaggaaatgcggggccctgtgcctgcaagcctggccccatgggctcaccaggccttccg
ggacttcctgggaggcagggtagtaagggagacttggggcccctcgggtggcctggagaa
aaaggtcacccaggccctcctggtgctgaaggatctccagggccaccaggagcacctggt
gccccaggaccgcctggcgacaaaggagaaaagggagacagggtggtagcgagagtgaaa
gggcacaaaggagaaagaggtcctgatggactcccaggacttccagggcagcggggacaa
catggttgggatggacatcctggcgcaccaggggatccaggacccccaggggatcatgaa
gacgcggccccgggcgaccgaggttttcctggacagccaggctccccgggcagagaaggg
ccaagggggcctccaggactgggatttcctggcccaccgggagaaaggggacagccagga
gctccaggccacctgggtgagaggggccccgacggcccaaagggtcagaaaggtgataca
atttcttataacgtcagctatcctgggaagccaggccctccgggtgctgatggacctcca
ggtccaagaggatttccaggtcctcggggtgctcctgggctgaggggctttgacgggcaa
aaaggttggcctggcaaaccaggaatatcagagatacctggcccacctggtgttcgtggt
gtcacgggagatccaggtttggaaggggacaagggctcctctcctgccggacccccaggc
cctcctggtttacctggaccggatggtcagaaaggaatccctggagacccctcttatggc
tacccaggacccccaggaaagaggggtccttcaggaatgccagggttgaaaggactcagg
ggtgacccaggacatcctgggcctgcagggccagctggcatgcccggaatcccgggtctc
aaaggtcctaaaggcagagagggaagtgctgggtttccaggtatcccaggtccacccggt
cattcctgtgaaagaggcgctcctgggataccagggccaccgggtctccctggggctcca
ggcagtccaggtgccccgggctggaaaggacagcgaggggatgcagggcctcctgggcca
gctggaatgaagggccttccaggggtcccaggaaggccaggggtagatggacccccagga
cccccaggaatcccaggcccctttggggacgatggactacctggtgttccaggccccaag
ggaccccaggggctgcctggcttgccaggttttcctggagagagaggaaagcctggcccc
gagggacaccgtggcagaaagggggacatcggagagaagggttggcctggcttccaggga
gaccagggagtgagaggcgccaaaggagacacaggatccccaggagatgaaggagaaatg
actataatttccaaaacgggggccactggggacactggacctcctggagatgatggaccc
cccggagaagaaggtgataaaggctatcctgggatgcctgggagaagaggagacccggga
agacccggaccacctggacttcacagaggagagcctggggaaaatgggcggccagggctt
cctggacccccaggccctccaggcttccctgggccgagagggatcattggttttcccgga
tttccaggtgatcagggtgagccgggtattccagggccccctggaccttccggacttgat
ggaatgagaggacccaaaggggacaaaggaggtcctgcaagtcagtttgggccgcctggt
ccgaagggtgagcccggcagccccggatgtccagggcatttgggagcccccggagagaag
ggcttgcctggagcagaagggcccagaggaccgccaggaaggccaggactgccgggtttc
cccggaccgcaggggtgtccaggtcatccagggaggcctgggccaatgggacctccagga
gaaatgggggatcctggaccaagcggccccatcgggcatcctgggccaccaggtcttcct
ggaataaaaggtccctctgggctacccggtctgaacggcttgcatggtttaaagggtcag
aaaggagccaaaggagcttcaggtttgtatgaaatgggcccacccggtccgatgggaatg
cctgggctgaaaggggagacaggagaccccgggagtccaggaatttctcctccaggcctt
tttggagaaaaaggccccccaggccctccagggagacctggaccgcctgggcctgcaggt
gccccaggaagagctcccacgggtgacattcctgacccgggcccacctggagatcaagga
cctcctggccctgatggtccacaaggaccgcccgggcctccagggccccctgggactgct
taccttgtgccaggagaaccaggtgactatggcctgccagggcccccggggcccccaggc
ccagcaggccctccaggacgcaaaggctacccaggatgtgacggggaagatggccggaaa
gggccaatgggattcccagggccgcaggggccacacggacttcctgggtcacctggagag
aagggcttaccgggccctccaggcagacaagggccccctgggcctccaggtcccagaggt
gaaccggggccaccggcagacttggatgcctgcccccgagtcccggggcttcctggggtg
ccaggcccaagaggaccagaaggagccatggggctccccggaatgagaggacctccagga
gcagggtgcaaaggagagcccgggctggctggcaggaggggcgaggatggcatcccaggg
cctcctgggcctcctggacacaaaggtgacatgggagaagctggcttccctggagcacca
ggccctcctgggcccactggggatcctgggcccagggggtttggccctgggtacctcagc
ggcttcctcctggtcctccacagtcagacggatggagagcccacctgccccatgggcatg
cccaggctctggacgggctacagcctgctgtacctggaaggacaggagagagctcacaac
caagaccttggtctggccgggtcttgcctgcccgtgttcagcacgctgcccttcgcctac
tgcaacatccaccaggtgtgccactacgcccggagaaacgaccggtcctactggctggcc
agcaccgcgcctctgcccatggcgccgctgtcggaggaggacatccgcccgtacatcagc
cgctgtgcggtgtgcgaggcccccgctcaggcggtggcgctgcacagccagaaccagtcc
atccccccgtgtccgcgggcctggcgcagcctctggatcgggtactccttcctgatgcac
acaggagccggggaccaaggaggagggcaggctctcatgtcacctggcagctgcctggaa
gacttcagagcagctccattcctggagtgccaaggccggcaggggacttgccactttttc
gcaaacaagtacagcttctggctgacagtggtaaaaccacacttgcagtttgctgaggca
ccgtcaccagacaccttgaaagacagtcaggcccagcgccagaaaatcagcaggtgccag
gtctgcgtgaaggtgagctag

KEGG   Desmodus rotundus (common vampire bat): 112309635
Entry
112309635         CDS       T05907                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2
  KO
K06243  laminin, beta 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112309635 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112309635 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112309635 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309635 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112309635 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112309635 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112309635 (LAMB2)
   05145 Toxoplasmosis
    112309635 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 112309635
NCBI-ProteinID: XP_024421630
LinkDB
Position
Unknown
AA seq 1801 aa
MGWAAGEGGKDLRGQPGPWELCVGLLLSVLATSLAQAPAPDVPGCAQGSCYPATGDLLVG
RADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRHPFSARNNPNSHRIQNVVTSFAP
QRRAAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGVPLAPPQHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPG
APAHAEGMVHGACVCKHNTRGLNCEKCRDFYHDLPWHPAEDSHSHACKKCECHGHTHSCH
FDMAMYLASGNVSGGVCDGCQHNTAGRRCELCRPFFYRDPTKDLRDPAVCRACDCDPMGS
QDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGYFGLSASDPVGCQRCQCDARGT
VPGGTPCDPKSGTCFCKRLVAGHGCNRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCSEA
TGECHCRQHMVGRRCDQVQPGYFRPFLDHLTFEAEDTRGQVLDVVERLASPGGTPTWTGP
GFVRLQEGQALEFLVTSVPRAMDYDLLLRLEPQVPEQWAEIELTVQRPGPVSARGPCGHV
LPKDDRISGTLQSDARYMVLPRPVCLEPGVSYKLHLKLLRTGGAAQPEAPYSGPSLLVDS
LVLLPRVLVLEMFSGGDAAALERRATFEHYRCHEEGLVPSKTPPSEACAPLLISLSALLY
DGALPCQCDPQGSLSSECNPHGGQCLCKPAVVGRRCDLCAPGYYGFGPTGCQACQCSPEG
SLSGLCEGISGQCPCRSGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECDTHTGACLGCR
DHTGGEHCERCIAGFHGDPRLPHGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIMCHCR
AGYTGLRCEACAPGYFGDPSRPGGQCQPCECSGNIDPTDPDACDPHTGQCLRCLHHTEGP
RCAHCKPGFHGQAARQSCHRCTCNLLGTDPRQCPSADRCNCDPSSGQCPCLPNVQGLSCD
RCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELHWGEPG
LQCRACDCDPHGIDTPQCHRATGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDW
DRVVQDLAARTRRLEQKAQELQQTGVLGAFESSFWRIQEKLGTVQGIVHARNISAASTAQ
LVEATEELRRQIGEATEHLTQLEAELTDVQDENYNANHALSSLERDGLALNLTLRQLDQH
LDLLKHSNFLGAYDSIRHAHSLSAEAERRANMSALAVPSPVSNSADTRHRTELLMGTQRE
DFNRKHMANQRALGDLSARTHNLSLTGINELVCGAPGDAPCATSPCGGAGCRDDDGQPRC
GGLSCNGAVAMADLALGRAQHTQTELQRALAEGGGILSQVAETRRQAGEAQQRAQAALDK
ANASRGQVEQANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAG
EIAERVRSLADVDTILARTVGDVHRAEQLLQDAQRARSRAEGEKQKAETVQAALEEAQRT
QGAAQGAIQGAVVDTRDTEQTLHQVQERMTGAEQALSSAGERAQQLDGLLEALKLKRAGN
SLAASSAEETASSAQGRAREAEQLLQGQLGDQYQTVKALAERKAQGVLAAQARAEQLRDE
ARSLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQDINLQVQIYNTC
Q
NT seq 5406 nt   +upstreamnt  +downstreamnt
atggggtgggccgcaggggaaggagggaaggacctgagaggacagcctgggccctgggag
ctctgcgtgggcctgctgctgagtgtgctggccacgtccctggcccaggccccagcccca
gatgtgccaggctgtgctcagggaagctgctaccccgccacgggtgacctgctggtgggc
cgagctgacagactgaccgcctcatccacctgtggcttgcatggcccccagccctactgc
atcgtcagtcacctgcaggatgagaaaaagtgcttcctgtgtgactcccggcaccccttc
tctgctagaaacaacccaaacagccatcgcatccagaatgtagtgaccagctttgcccca
cagcgccgggcagcctggtggcagtcagagaatggtgtccctgtggtcaccatccagctg
gacttggaggctgagttccatttcacgcacctcattatgaccttcaagacgtttcgccct
gccgccatgctggtggagcgctcagcagactttggacgcacctggcatgtgtaccgatat
ttctcctatgactgtggggctgacttcccaggagtcccactggcccccccacagcactgg
gatgacgtagtctgtgagtcacgctactcagagatcgagccgtccactgaaggggaggtc
atctatcgtgtgctggaccctgccattcctatcccagacccttatagcccacggatccag
aacctgctaaagatcaccaacctgcgggtgaacttgacacggctgcacacgctgggagac
aacctgttggacccacggcgggagatccgagagaagtactattatgctctctacgagctg
gttgtgcgtggcaactgcttttgctacggacatgcctcacagtgtgcacccgccccaggc
gcaccagctcatgcggagggcatggttcatggggcctgcgtgtgcaagcacaatactcgc
ggcctcaactgtgagaagtgtcgcgatttctatcacgacctgccctggcatccagctgag
gacagccacagccatgcctgcaagaagtgcgagtgccacgggcacacgcacagctgtcac
tttgacatggccatgtacctggcatctggcaacgtgagtggaggcgtgtgtgatggatgt
cagcataacacagctgggcgccgctgtgaactctgccggcccttcttctaccgtgaccca
accaaggaccttcgggatccagccgtgtgccgtgcctgtgattgtgaccccatgggttcc
caagacggtggtcgctgtgatccccacgacgaccctgcactagggcttgtctcgggccag
tgtcgctgcaaagaacatgtggtgggctctcgctgccagcaatgccgtgatggctacttt
gggctcagtgccagtgaccctgtaggctgccagcggtgtcagtgtgatgcacggggcaca
gtgcctgggggcaccccttgtgaccccaagagtggaacctgtttctgcaagcgtctagtg
gcgggacatggctgcaatcgctgcctgcctggccactggggcctgagccacgacctgctc
ggctgccgcccgtgtgactgcgacgtgggtggtgccttggatccgcaatgcagtgaagcc
acgggtgagtgccactgccgccagcacatggtggggcgacgctgtgatcaggtccagcct
ggctacttccggcccttccttgaccacctaacgtttgaggctgaggacacccgaggccaa
gtgcttgatgtggtggagcgcctggcaagccccgggggaactccgacctggacaggcccg
ggctttgttaggctgcaggaaggccaggcactggagttcctggtgacctctgttccaaga
gccatggactatgacttgctgctgcgcttggagccccaggtccctgagcaatgggcagag
atagaactgaccgtgcagcgcccagggcctgtgtctgcccgcggcccatgcgggcacgtg
ttgcccaaggacgaccgcatctcggggactctgcaatctgacgccagatacatggtgctt
cccagacctgtctgcctggagcctggtgtctcctacaagctgcacctgaagctgttgaga
acagggggagctgcccagcccgaggccccctactccggacccagcctgctcgttgactcg
ctggtgctgctgcctcgtgtccttgtgctggagatgtttagcgggggtgacgctgctgcc
ctggagcgccgggccactttcgaacactaccgctgccacgaggagggtctggtgcccagc
aaaacccctccctctgaggcctgtgccccgcttctcatcagcctgtcagcgctgctctat
gatggcgccctgccctgccagtgtgacccccagggctcgctgagttctgagtgcaaccct
catggcggtcagtgcctgtgcaaacctgcagtggtcgggcgccgctgtgacctctgtgcc
cctggctactatggctttggccccacaggctgtcaagcctgccagtgcagccctgagggc
tcgctcagcggcctatgtgaagggatcagtgggcagtgcccctgccgatctggtgccttt
ggacttcgctgcgaccgctgccagcgtgggcagtggggattccctagctgccggccatgt
gtctgcaatgggcatgcggatgaatgcgacacccacactggcgcttgcctgggctgccgt
gatcacaccgggggtgagcactgtgaaaggtgcattgcaggcttccatggggaccctcgg
ctgccacacgggggccagtgccggccctgcccctgccccgaaggccctgggagccagcgg
cactttgccacttcttgccatcgggatgggtactcccagcagatcatgtgccactgcagg
gcaggctacacggggctgcggtgtgaagcttgtgctcccgggtactttggggacccatca
aggccaggtggccagtgccaaccatgcgagtgcagtgggaacattgaccccacggacccc
gatgcctgtgatccccacacggggcaatgcctgcgctgcttacaccacacagaggggcca
cgctgtgcccactgcaagcctggcttccacgggcaagctgcccgacagagctgtcaccgc
tgcacatgcaacctgctgggcacggatccccgccagtgcccatccgctgaccggtgcaac
tgtgacccaagcagcgggcagtgcccgtgcctgcccaatgtccagggccttagctgtgac
cgctgtgcccccaacttctggaatcttaccagtggtcacggctgccagccctgtgcctgc
cacccaagtcgagccagaggccccacctgcaacgagttcacggggcagtgccactgccat
gcgggctttggtgggcgaacctgctctgagtgccaggagcttcactggggagagccgggg
ttgcagtgccgtgcctgtgactgtgaccctcatggaatagacacgcctcagtgtcatcgt
gctacgggtcactgcagctgccgcccaggtgtatctggagtgcgctgtgaccagtgtgcc
cggggcttctcgggtgtctttcctgcctgccacccctgccatgcatgttttggggactgg
gaccgagtggtgcaggacttagctgcccgtacacggcgcctggagcagaaggcgcaggag
ctgcagcagacgggtgtgctgggtgcctttgaaagcagtttctggcgcatacaggagaag
ctgggcactgtgcaggggattgtgcatgcccgcaacatctcagctgcctccactgcacag
cttgtagaggctacagaggagctgcggcgtcaaattggggaggccactgagcatctgacc
cagctggaggcagagctgacagatgtgcaggatgagaactacaatgccaaccatgcacta
agcagtctggagcgagacgggcttgcccttaatctcacactgaggcagctggaccagcat
ctggacctgctgaagcattcaaacttcctgggtgcctacgacagcatccgccatgcacac
agcctgtctgcagaggcagaacgtcgtgccaacatgtcagccctggcggtgcccagccct
gtgagcaactcagcagacacccggcaccggacagagttgctgatgggtacccagagggag
gactttaaccgcaagcacatggccaaccagcgggcactgggagatctctctgcccgtacc
cacaacctgagcctgacaggcataaatgaactggtgtgtggggctccgggggatgcaccc
tgtgctacgagcccttgtgggggtgccggctgccgggatgacgatgggcagccccgctgt
gggggcctcagctgcaatggggcagtagccatggcggacctggcactgggtcgggcccag
cacacacagacagaactgcagcgggcactggcagaaggtggtggcatcctcagccaggtg
gcagagacccgtcggcaggcaggcgaggcacagcagcgggcccaggcagccctggacaag
gctaatgcttccaggggacaggtggagcaggccaaccaggaactgcgggaacttatccag
agtgtgaaggacttcctgagccaggagggggctgatcccgatagcattgagatggtggcc
acacgggtgctagagctctccatcccagcatcacctgagcagatccagcacctggctggc
gagatcgcagagcgggtccggagcctggcagacgtggacacgatcctagcgcgcactgtg
ggagatgtgcatcgggcggaacagctactacaggatgcacagcgggcacggagccgggct
gaaggtgagaaacagaaggcagagacagtacaggcggctctagaggaggcccagcggaca
cagggtgctgctcagggtgctatccagggggcagtagtcgacacacgagacacagagcag
accctacaccaggtgcaggagaggatgacaggtgcagagcaggcactgagctcagcaggc
gagcgggctcagcaactggatggtctcctggaggctctgaaattgaaacgagcagggaat
agtctggcagcctctagtgctgaagaaacagcaagcagtgcccagggtcgtgccagagaa
gctgagcagctgcttcagggccaactgggcgaccaataccagacagtcaaggccctggct
gagcgtaaggcccagggtgtgctggcggcgcaggcacgggcagagcaactgcgggatgag
gctcggagcttgttgcaggcggctcaggacaagctgcagcggctgcaagagctggagggc
acctatgaggagaacgaacgtgcgctggagggcaaagcagcccagctggatgggctggag
gccaggatgcgcagcgtacttcaagacatcaacttgcaggtccagatctacaacacctgc
cagtga

KEGG   Desmodus rotundus (common vampire bat): 112309774
Entry
112309774         CDS       T05907                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit beta-2-like
  KO
K06243  laminin, beta 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112309774
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112309774
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112309774
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309774
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112309774
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112309774
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112309774
   05145 Toxoplasmosis
    112309774
SSDB
Motif
Pfam: Laminin_EGF Laminin_N RNase_Y_N
Other DBs
NCBI-GeneID: 112309774
NCBI-ProteinID: XP_024421747
LinkDB
Position
Unknown
AA seq 1941 aa
MGFQAPLDVLPSLDVISTQTLSFPVQAHRTIAQEMPDTLFPPGCSFGSCYPPIGHLLIGR
AQNLHASSTCGLHSPEPYCTVSHFQDAEDCFFCDSWDRGGHGIENVISPSGPTGSKTWWR
AESGVENVTIQLDLESAFYFTHLVMTFKVTQPETLNLERSVDHGCSWHVYQYFAQNCSRL
FPGIPLAPGHRVGDLVSDQHYSDIEPPTEDKVRPRGRGFGPWSEARGSGLLIPQMVDKQA
NQCPMWFGXWAGDGILYRIGEAGFRCLEMPEWGIQEAVGCACLSSGRIPGLEQCRDGITT
IRLWSSSNGIPRGTGTGKSHSRGAGGAGCNDXQRGERQPPIPCPNSSHSRMTSRAPEASQ
SVSSXLLHVTNLRVNFSELHNLGDRPLGGLKGHPFYYYALYELVARGSCLCHGHASECRP
APGAPANVEGMVRGLCVCRHHTAGAHCERCGDLHQDHPWHPAELGHPHACRKCQCHGHTH
SCHFDMALYLASGNMNKGMCDACQHNTAGRRCELCWPFFHRDPQEDPRYPHSCKPCDCDP
VGALEGGLCDAHTDETHGLLSGQCRCKVNIWGQRCDSCRPGHYGLSLTHSEGCQPCRCGP
RGRVPGIHACDPSSGACHCKRFVSGQDCSHCLPEFWGLSNDSLGCRPCDCDFGGAYSNRC
SAGEDVCLCHPHLHGHRFHELQSRYFCTALDQATAEAKLGQSLQTADPQLPGAPWPAPSH
CTQASGSSPHWLQTRLQRQRDPXCALHPIRXACYSHQPLTAPEEPVSLHLGAGFTLQTGL
DFARVVSGAGLSLLAPTVPRALEYAIVLXYETQASKDXQALVSVCAQSLPSKTHCAHLLP
SEXLFQATLTHAHRAVVLSIPFCFEPGAHYSVTLRLWRTKAGRRPEGGIIFLGSVALLPR
VKELPGLRPVDPEATGRLQELRKAGCTEAVRTGLPGAMPEACAHLLCSISALLHGGDLPC
ECHPQGLLSTECTLMGGQCPCRPNIIGHTCDHCVQNMWLGTCGLGPTGCSECRWHSKGAT
SAICNPVSGQCTCRAPLARHRCDRCLPDQWGFPHCQPCVCNGHAELCHPLTGVCQACHRA
TTGRHCERCLDGYCGDPTLGSGQRCWPCLCPGPPSSGLYHGTSCHMDSASGRVLCLCAPG
YAGPHCDRCSSGYFGCPRPGGDPRRSLCWPCQCNNIDPRDPTACDPNSGHCQRCLHHRHG
PGCAHCRPGFHGSALRPGGWHECCSCDPWDTIPSRCPSGAEACFCNQLSRQCPCCPHTLG
QDCSLCVPLFWNLGGLQGCEPCSCHAHHSLHPACHPVTGQCPCWAGFGGHTCSQYQDGYW
GDPEQECRACACDPQGSISPGCDLYTGACLCREDILGPKCQACACGSRGGFPHCTTCPAC
FTSWDQHLVLLQLQLEAVAQEAAALYQGTPGWGVRDQGGCQQALEAVLQQAQTLLESPSP
TVGILQQLTEWIAGLRRAMTELAQMGWAPGQVVAESKSRVRGQCERLEELSWELDSLKGL
ASPKRAIGVQDAEAQASSVALLSXEAMLRAQTVASLGGPDSILGQAREARRCTEQLLWGT
GQPTRIAMWKLKLKGLVDRVQMLHPQLLRLLVKAGVECRGRGPGLACVPVPSVVPACPGP
LPTAQWALVISRNASYSPDIVIAALEQHQQLLQEIQATASSTGIQAREMWHRARGPWGMA
STAPVQATVHKIQCFLLEEGADAMSVELVAWRGLAVPLPQGRAAGMALLLDQIQSALPSP
DAGGQELPKAGGVLDQAQXTREGTARAQDQALGVXGLLAEAGTDARAAEQGLQASKQILR
GLEASVQELTMAGHLAWITLAVAVTPGLLSSAAVALRNRLALSQRQAQQAEERSAHAMGL
AEGRARCGRVAGERVQQTRAEAQELRKQVQNSWSRLQGLERRLVQNEQTLGKRAATMWTL
EKQAAELLEHLQLWASACATC
NT seq 5826 nt   +upstreamnt  +downstreamnt
atgggcttccaggcccctctggatgtcctgccctctctagatgtgatctctactcagacc
ctatccttcccagtccaggctcacagaacaattgcccaggagatgccagacacacttttc
ccacccggctgctcatttggcagctgctacccacccatcggccacctgcttattggccgt
gcccagaatcttcatgcctcgtccacctgtggactccatagccctgagccctactgcact
gtcagtcacttccaggatgctgaagattgcttcttttgtgactcttgggaccgtggtggc
catggcattgagaatgtgatctccccaagtggacccactggcagcaagacctggtggcga
gctgagagtggtgttgagaacgtcaccatccagctagacctagagagtgccttctacttt
acccacctcgtcatgactttcaaggtgacccagcctgaaactctgaacctcgagcggtca
gtggaccatggctgctcctggcacgtgtaccaatactttgcccaaaactgctcacgcctc
tttcctgggatccctcttgcccctggccacagagtcggtgacctcgtctctgatcagcat
tactcagacattgagcctcccactgaggacaaggtcaggcccagaggaagggggtttggg
ccctggagtgaagccagaggctcaggcttgcttattcctcagatggtggataaacaagca
aaccaatgccctatgtggtttggatgatgggccggggatggaatcctttaccgcattggg
gaagcaggtttcagatgtctagagatgccagaatggggcatccaggaggcagtggggtgt
gcatgcctcagctcgggaaggataccagggctggagcagtgcagagatggaattaccacc
attaggctgtggtcatcctcaaatggtattcccaggggaacagggacagggaagtcccac
agtaggggtgctgggggagctggctgcaatgatnnacagagaggagagagacagcccccc
attccttgcccaaattccagccatagcagaatgacaagcagagcacctgaggcctcacaa
tctgtctctagtnngctcctgcatgtgactaacctccgtgtgaacttctccgaactgcac
aacctgggtgacaggcccctgggaggcctcaagggacaccccttctactactatgccctc
tatgagcttgtggccagaggcagctgcctgtgccatggccacgcctctgagtgcagacct
gcgcctggggcaccagccaatgtggaaggcatggtgcgtggcctttgcgtctgccgccat
cacacagcaggtgcccactgtgagcgctgcggggacctgcaccaggaccacccatggcac
ccagcagagcttgggcacccccatgcctgccggaagtgccagtgccacgggcacacccac
agctgtcactttgacatggccctctacctggcttctggcaacatgaacaaaggtatgtgt
gatgcgtgtcaacacaacacagctgggcgccgctgtgagctctgctggcccttcttccac
cgagacccccaggaagatccccgttaccctcactcctgcaaaccctgtgactgtgaccct
gtgggtgccctggaagggggattgtgtgatgcccacacagatgagacccacggcctcctc
tctgggcagtgtcgctgcaaagtaaacatctggggccaacgctgtgactcctgccggccg
ggtcactatggcctgagccttacccactcagaaggctgccagccctgcaggtgcggcccc
aggggccgagtccctggcattcatgcctgtgatccgtccagcggtgcttgtcactgcaaa
cgctttgtctctggacaggactgcagccattgtctgcccgagttctggggtctgagcaat
gactctctaggctgcaggccctgtgactgtgactttgggggtgcctacagcaacaggtgt
tctgcaggggaggatgtatgtctgtgccacccccatctccacggccatcgcttccatgaa
ctccaatctcggtacttctgcactgcccttgaccaggccactgctgaagccaagctcggc
cagagcctccagacagctgaccctcagctgcctggagccccctggcctgctccttcccac
tgtacacaagcctcagggagctcccctcactggctccagacccgacttcagagacagcgt
gacccttgatgtgccctccaccctatcaggtgagcctgctacagccaccagccactcaca
gccccagaggaacccgtgtccctgcatctgggagctggcttcacactgcagactggctta
gactttgcacgtgtagtcagtggggctggcctctctctgctggctcccacagtgcctcgt
gccctggagtatgccattgtcctgnnctatgagacccaggcatctaaagactgacaggca
ttagtcagtgtttgtgcccaatctctgcccagcaaaactcactgtgcccacctgctgccc
tcggagncactcttccaggccaccttgacccatgcacacagagctgtggttctatccata
cctttctgctttgaaccgggagcacattactccgtgaccctgcgcctgtggcggaccaaa
gcgggccggaggcctgagggaggcatcatctttctgggttcggttgcactccttccaagg
gtgaaggagctgcctgggctgagacctgtggaccctgaggccacagggcgcttgcaggag
ctccgcaaggcaggctgcacggaggcagtgaggacgggcctgcccggcgccatgcccgag
gcctgtgcccacctcctctgcagcatctcggccctgcttcatgggggtgacctcccatgt
gagtgccacccccagggtttgctgagtactgagtgcaccctgatgggtgggcagtgcccc
tgccgccctaacatcattggtcatacctgtgaccactgtgtgcagaacatgtggcttgga
acatgtggcttgggtcccaccggctgcagtgagtgccgctggcattccaagggtgccacc
agtgccatctgtaaccctgtgagcgggcagtgcacatgccgggcgccccttgctcgtcat
cgctgtgaccgctgcctccccgaccagtggggcttcccacactgccagccctgtgtctgc
aatgggcatgctgagctgtgccacccacttacaggcgtctgccaggcctgccacagagcc
acgacaggccggcactgtgagaggtgcttggatggctactgcggagaccccaccctgggc
tcaggccagcggtgttggccctgcctctgtcctgggccccctagctctggcctctatcat
gggacttcctgccatatggacagtgcaagtggacgtgtcctgtgcctctgtgcacctggc
tatgcagggccccactgtgaccgctgttcctcgggctactttgggtgccctcggccagga
ggggaccccagaaggagtctgtgctggccctgccaatgtaacaacattgacccccgggac
cccactgcctgtgaccccaacagtgggcactgccagagatgtctgcaccacagacatggc
cctggctgcgcccactgcaggcctggcttccacggcagtgccttgcgcccagggggctgg
catgagtgctgcagctgtgatccctgggacaccatcccttcgaggtgcccatctggggct
gaagcctgcttctgcaaccagctcagcaggcagtgcccatgctgcccccacacactaggg
caggactgcagcctctgtgtccccctcttctggaacctagggggacttcaggggtgtgag
ccctgcagctgccatgcgcaccactctctgcatccagcgtgtcacccagtcacaggtcaa
tgcccctgctgggcaggatttgggggccacacgtgctcccagtatcaggatgggtactgg
ggtgacccagagcaggagtgcagagcttgtgcctgcgacccacagggctccatctcaccc
ggctgtgacctgtacacaggtgcctgcctctgcagagaggacatcttggggccgaagtgc
caggcatgtgcctgtggctccagaggtggcttcccacactgcacgacctgccctgcctgt
tttacctcctgggaccaacacctggttttgctccagctgcagctggaagctgtggcccag
gaggcagctgccctataccaggggactcctggctggggtgttagggaccagggtggatgc
cagcaggccctggaggcagtcctgcagcaggcacagacgctcctggaatctccttcaccc
actgtggggatcctgcagcaacttacagagtggatagctggactcaggagggcaatgact
gaactggcccagatggggtgggctccaggacaggttgtggcagaaagcaagtcacgggtt
aggggacagtgtgaacgtctggaagaattatcctgggagctagactctctcaagggcttg
gcctcacccaagagggccataggagtccaagatgctgaagcccaagcctcctcggtggcc
ctgctttcctaggaggccatgctcagagcccagactgtggcctcacttggaggaccagac
agcatcctgggtcaggcccgagaggcccggcgatgcacagagcaacttctgtgggggaca
ggccagcctacaaggatagctatgtggaagctgaaactaaaggggctggtggacagggtc
cagatgctgcacccacagcttctgaggctcctggtcaaagccggagtggaatgcaggggc
cggggccctgggctggcctgtgttcctgtaccctctgttgttcccgcttgccctgggccc
ctgcccactgcccagtgggctctggtcatctcccgtaatgcctcttacagcccggatata
gtgatcgcagccttggagcagcatcagcaactgctgcaggagatccaagccacagcaagc
tccacgggaatccaggctagagagatgtggcatcgagccagggggccctggggtatggcc
tccacagcccctgtgcaagcaacagtgcataagatccagtgtttccttttggaggaaggt
gcggatgctatgagtgtggagctggtggcgtggcgtgggctggctgtgcccctcccccag
ggcagggcagctggcatggccctcctgctggatcagatccagagtgccctcccttccccg
gacgctggaggccaggagctgcccaaagctggaggtgtccttgatcaggcacagtagacc
agggagggcacagccagggcccaggaccaagctctgggtgttnncgggttgctagctgag
gcaggaactgatgcaagggctgcagagcaagggctgcaggcgtcaaagcagatactcaga
ggcctggaggccagtgtacaggagttgacaatggcagggcacctggcctggataacactg
gcagtggctgtgacccctgggcttctgtccagtgcagctgtggctctcaggaaccgcttg
gccctgagtcagcggcaggcccagcaggcagaagagcgttcagcacatgccatgggcttg
gctgagggccgggcgaggtgtggcagagttgcaggagagcgggtgcagcagacgcgagct
gaggcccaagagctgcggaagcaggtgcagaacagctggagccgtctgcaggggttggag
cgccgcctggtgcagaatgagcagaccttgggcaagagggcggccacaatgtggaccctg
gagaagcaggcagcagagctgcttgagcacctgcagctgtgggccagtgcatgtgccacc
tgctga

KEGG   Desmodus rotundus (common vampire bat): 112321420
Entry
112321420         CDS       T05907                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04974  Protein digestion and absorption
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112321420 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112321420 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112321420 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112321420 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    112321420 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321420 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112321420 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112321420 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112321420 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112321420 (COL4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112321420 (COL4A2)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112321420 (COL4A2)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112321420 (COL4A2)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112321420 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112321420
NCBI-ProteinID: XP_024434605
LinkDB
Position
Unknown
AA seq 1711 aa
MDRDRCTPLGPALQRWLLLVALTVGLLAHSGLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYTGPPGLQGFPGLQGRKGDKGERGAPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGPPGYDGCNGTRGDVGQQGHPGPEGFPGPAGPHGPKGQKGEPYALSKEDRD
KYRGEPGEPGLVGFQGPPGRPGPMGPMGPVGVPGRPGPPGPPGPKGQQGNRGLGFYGEKG
EKGDMGQPGPNGIPSDTNREIVGPTSSVIPSDPYKGEKGSMGEQGRVGISLKGEEGIMGF
PGLRGYAGIDGEQGAQGQKGSRGLDGYPGPDGPRGPKGEVGDRGLPGPPPYIPHPSLAKG
GRGDPGFPGARGEPGTQGLPGDPGPAGLPGTSGISEGGRRGTPGEMGPKGFIGEPGIPAL
YPGSPGVAGKPGLPGFQGPAGPPGPDGFLFGLKGTPGQVGFPGTPGFPGSRGQKGGKGDY
GDCKCADDQFIRGLPGPPGPRGFPGNHGEPGRKGFQGDPGQHGTPGFPGLKGAPGDFGPP
GPKGIKGDSRTITTKGEKGQPGIPGVPGIKGGDGIPGRDGLDGFPGLPGPPGDGIKGPPG
DAGYPGAPGTKGIPGERGPPGLGLPGPKGQRGFPGDAGFPGVPGLPGPPGPPGLPGQIDC
DTGVKRPIGGDGQDVIQPGCIGGPKGLPGQPGPPGPTGAKGLRGIPGFPGVDGPPGPKGL
AGDPGREGFPGPPGFVGPRGSKGSMGLPGPDGLPGPSGLPGLVGPPGDRGLPGEVLGAQP
GSRGDAGLPGHPGLKGLPGERGPPGFRGSQGMPGMPGLKGIPGFPGPLGQPGLPGPPGLH
GFPGAPGPEGPLGLPGTIGHEGLPGERGDPGDTGVPGPLGMKGVPGDRGDLGFFGERGPP
GNPGFTGMAGMPGAPGLKGERGSPGMDGFQGMLGPQGRPGLPGNKGEPGLFGVPGLKGLA
GWPGVKGNRGEPGPPGPPPIIEPGMKYIKGEKGDEGPMGLKGYLGLKGLPGMPGIPGLSG
IPGLPGQPGYVKGVKGDIGAPGIPGLPGFPGVPGSPGIIGFPGFTGSRGDKGSPGRTGLY
GEAGPTGDIGDIGDTINLPGSPGLKGERGVIGAPGLKGFFGQKGAEGDIGFPGITGIAGA
QGPPGLTGQTGFPGQAGLRGQQGDPGRVGVPGKKGDHGWPGIPGLPGLPGIQGIGGLHGL
PGTKGSPGSPGEDIHGDPGFPGPAGDRGEPGEANILPGPAGVPGQKGERGAPGERGPVGS
PGLQGFPGVTPPSNISGLPGDQGPAGIFGLKGYPGLPGPPGPAALPGSKGDEGNPGAPGN
PGTKGWVGDPGPQGQPGVYGVPGERGPRGEQGIMGNTGITGSVGDRGPKGPKGDRGLPGA
PGPLGSPGIAGIPQKITVQPGPMGPQGKRGPPGAQGEMGPQGPPGEPGFRGHPGKAGPQG
RGGVSAVPGFRGELGPVGHQGPVGQEGEPGRPGTPGLPGMPGRSVSIGYLLVKHSQTEQE
PMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDICYYASRN
DKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWI
GYSFLMHTAAGDEGGGQSLMSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPE
QSFQSSPSSDTLKAGLIRTHISRCQVCMKNL
NT seq 5136 nt   +upstreamnt  +downstreamnt
atggacagagaccggtgcacgccgttgggccctgccctgcaacggtggctgctgctggtg
gcgctgacagtgggactcctggcccacagcggcctggcgggtgtgaagaagtttgatgtg
ccttgtggagggcgagactgcagtgggggctgtcagtgctaccctgagaaaggagggcgg
ggtcagccagggccagtgggcccccagggatacactgggcccccagggttacaaggattc
ccaggactgcagggccgcaaaggtgacaagggagaaagaggcgctcctgggatcacagga
ccgaaaggcgatgtgggagcaagaggcgtttctggattccctggtgctgacggaattcct
ggacaccccgggcaaggtggacccagaggaccacctggctatgatggctgcaatgggacc
aggggagacgtgggccagcagggacaccctggccctgaaggcttccccggacctgctggg
ccccacggacccaaagggcagaaaggtgaaccttacgcactatctaaagaggaccgtgac
aaatacaggggtgaacctggagagcctggattggttggtttccaggggcctcccggccgc
cctgggcctatgggaccaatgggtccagttggagttccaggaagaccaggaccgcctgga
ccccctggaccaaaaggacagcaaggcaacagaggacttggtttttatggagaaaagggt
gaaaagggcgacatgggacagccaggacccaatgggattccatcagacaccaaccgtgag
atcgtagggcccacgagttcagtcatcccttcagatccgtataagggtgaaaaaggaagc
atgggggaacaaggaagagtgggcatttccttgaaaggagaagaaggaatcatgggcttt
ccaggactccggggttacgctggcatagatggcgagcaaggcgcacaaggacagaaagga
agcagaggactggatggctacccaggccctgatgggccccgaggacccaagggagaagtg
ggtgaccgaggcctcccagggccacctccctacatcccccatccttctctagctaaaggt
ggcagaggtgacccgggatttccaggggcccgtggggagccaggaacacagggtctgcca
ggtgaccccggcccagcaggcttgcccggcacatctggcataagtgaaggtgggcggaga
ggcaccccaggtgaaatgggacccaaaggcttcataggagaaccgggcatccctgcgctc
taccccggttcgccaggagttgcagggaagccaggactcccaggattccaagggcctgct
ggaccaccgggaccagatggtttcctttttggccttaaaggaacaccaggacaagtgggc
tttcctgggactccaggtttccctgggtctcgcggacagaaaggagggaaaggtgattat
ggggactgtaaatgtgccgatgatcagttcatcaggggtcttccaggaccacctggaccc
aggggcttcccaggcaaccatggggagccaggaaggaaagggttccaaggagatcctggc
cagcacggcacccctgggttcccagggctcaagggagcccctggtgactttggacctcct
ggacccaaaggaataaagggagattctagaacaattactaccaaaggtgagaagggacaa
ccaggtatcccaggtgtgcctgggataaaaggtggcgatggcatcccggggcgtgacggg
ctcgatggattcccaggccttccaggccctcctggtgatggcatcaaaggccccccaggg
gacgcaggctacccaggagcacctggcaccaagggcattccaggagaaaggggtccccca
ggactgggcctcccaggtcccaaaggccagcgtggtttccctggagatgctggattccct
ggagtgccaggcctccccggacctccgggccccccaggcctcccaggacaaatagattgt
gacacaggtgtgaaaagacccattggaggtgatggacaggatgtcatccagccaggttgt
attggagggcccaagggattgccaggccagccaggccccccaggccccacaggtgccaaa
ggcctcagagggataccaggattcccaggagtggatggaccaccaggacccaagggtctc
gcaggagatccagggcgtgaagggttcccaggacccccaggattcgtggggccccgagga
tccaaaggctcgatgggcctccctggccctgatggactcccaggtcccagcggcctacca
ggactagtcgggcccccaggggacaggggccttcctggtgaagtcctgggagcccagcct
ggatcccggggagatgctggactgcctggacaccctgggctgaaaggccttcctggagaa
agaggcccacctggattcaggggaagccaaggaatgccaggaatgccaggcctgaagggt
atcccaggcttcccaggacctctcggtcaaccaggactgcctgggccaccagggctgcat
ggcttccctggagctcccggcccggaggggcccttggggctgccaggcaccataggccat
gaaggtctgcctggagaaagaggggacccaggtgacacaggtgtccctggccccttgggc
atgaaaggtgtccctggtgatagaggtgatcttggtttcttcggtgagagaggccctcca
ggaaaccctggctttacaggaatggccggaatgcctggtgcccctggactgaaaggggag
agaggttcacctgggatggatggtttccaaggcatgcttgggccccagggaagacctggg
cttcccggaaacaaaggagagcccgggttgttcggagttccagggctaaaggggctggct
ggctggccaggtgtgaaaggaaaccgaggggagccaggtcccccaggaccacctcccatc
atcgagccaggaatgaaatacattaaaggggagaaaggagatgaaggacctatgggttta
aagggctacctgggcctaaaaggccttccaggaatgccagggatccctgggctgtcgggc
atccctgggttgcctgggcagcccggctacgtcaaaggagtcaaaggagacatcggagct
cctggcatacctgggttgccgggattccctggtgtgcctggctcccccggaattataggg
tttccaggcttcacaggaagtaggggtgacaagggttctccggggagaacaggtctttat
ggtgaggctggccccacaggtgacattggtgatattggagacactataaatttaccagga
agcccaggcctgaaaggggaacgaggtgtcattggagcaccaggtctaaagggattcttt
ggacagaaaggagcagaaggtgacatcggcttccctgggataacaggcatagcaggagcc
caaggccctcctggacttacagggcaaacaggctttccaggacaggcgggcctgagaggg
cagcaaggagaccctggccgggttggagtgcctggcaagaaaggagatcatggctggcca
ggtattccaggcttaccaggtttaccaggcatccaaggcatcggtggattacacggcttg
ccaggcaccaaaggctctccaggatccccaggtgaagacatccatggagacccaggtttc
ccaggtcctgcgggggacaggggtgagccaggagaggccaacatccttccaggccctgcc
ggagtcccaggacaaaagggggagcgaggagctccaggggaacgaggcccagttgggagt
ccaggacttcaagggtttccaggcgtcacacccccttccaacatttctgggttgcctggt
gaccaagggccggcggggatatttggcctgaaaggttacccaggcctcccagggccacct
gggcctgctgctcttcctggaagcaaaggagatgagggaaacccaggagctccaggaaac
ccagggaccaaaggatgggttggggaccccgggccccaaggccagcctggcgtgtatggt
gtcccaggagaaagagggcccagaggtgaacaaggaatcatgggaaacacaggaatcacg
ggaagcgtgggcgaccgaggcccaaagggacccaaaggagaccgaggactcccgggtgcc
cctggtcctttgggatccccagggattgcaggaatcccccagaagattactgtccagcct
gggccaatgggtccgcagggaaagagaggccccccaggcgcacagggagagatgggaccc
cagggtcccccaggagaaccaggttttcgagggcatccaggaaaggcagggccccaggga
agaggcggtgtgtctgccgtgcccggattccgaggagagctgggacccgtggggcaccag
gggcctgttggccaggagggggagccaggccgcccagggacccccggcctgcccggcatg
cctggccgcagtgtcagcattggctacctcctggtaaagcacagccagacagaacaggag
cccatgtgccccgtgggcatgaacaagctctggagtggatacagcctgctgtactttgaa
gggcaggagaaagcccacaaccaggacctggggctggcgggctcctgcctggctcggttc
agcaccatgcccttcctgtactgcaaccctggggacatctgctactatgccagccggaat
gacaagtcctactggctctccaccactgccccgctgcctatgatgcctgtggccgaggac
gaaatcaagccctacatcagccgctgctccgtgtgcgaggccccagccgtcgccatagca
gtccacagtcaagatgtctccatcccccactgcccggctggatggcggagcctgtggatc
ggctattccttcctcatgcacactgccgcgggcgatgaaggtggtggccaatcgctgatg
tcgccaggcagctgtctggaggacttccgcgccacaccgttcatcgagtgcaatgggggc
cgggggacctgccactacttcgccaacaagtacagcttttggctcaccaccatccccgag
cagagcttccagagctcgccctcctccgacacgctcaaggcggggctcatccggacacac
atcagccgctgccaggtgtgcatgaagaacctgtga

KEGG   Desmodus rotundus (common vampire bat): 112321451
Entry
112321451         CDS       T05907                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04974  Protein digestion and absorption
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112321451 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112321451 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112321451 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112321451 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    112321451 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321451 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112321451 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112321451 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112321451 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112321451 (COL4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112321451 (COL4A1)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112321451 (COL4A1)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112321451 (COL4A1)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112321451 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112321451
NCBI-ProteinID: XP_024434628
LinkDB
Position
Unknown
AA seq 1675 aa
MSGDEQEFLGQNVDTSNTCCREWLRTLNPVIIQGGGCAGSGCGKCDCHGVKGQKGERGLP
GLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGVSGYPGNPGLPGIPGQD
GPPGPAGIPGCNGTKGERGPLGPPGLPGFTGNPGPPGLPGMKGDPGEIIGHVPGMLLKGE
RGFPGHPGIPGMPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQ
GVSGPPGVPGQAQVQEKGDFATKGEKGQKGEPGYQGVPGFGEKGEPGKPGPRGKPGKDGE
KGEKGSLGFPGDVGLPGLPGREGLKGDKGEAGPPGPPGTVIGPGILGEKGERGYPGSPGL
RGEPGPKGYPGLQGQPGPPGISIPGQPGVPGFPGERGEKGDQGLPGVSLPGPSGRDGLPG
PPGPPGPPGQPGHTNGIVECQPGPIGDPGPPGTPGHPGLAGEVGEKGQKGDSCLVCDTAG
LRGPPGPQGPPGETGFPGQPGAKGEKGLPGRDGLEGLPGPQGTPGLMGQPGAKGEPGEIY
YDVQLKGDKGDPGFPGQPGIPGRAGAPGRDGHPGLPGPKGSPGLIGLKGDRGPPGGVGFP
GSRGDIGPPGPPGYGPIGPVGDKGQAGLPGNPGSPGQPGLRGEAGRVMPLPGPPGADGLP
GSPGFQGPQGDRGFPGTPGRPGLPGERGAVGQPGIGFPGPPGPKGVDGIPGDVGLPGNPG
RPGPNGLPGNPGLPGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGGPGIPGEHGAIGP
PGLQGSRGDPGPPGLQGPKGAPGVPGIGPPGVMGPPGRQGQPGSSGPPGVKGEKGFPGFP
GLDMPGPKGDKGSQGLPGLKGQSGPPGFPGQQGAPGLPGVQGLKGEMGVMGTPGQPGSPG
RVGLPGLPGEKGDHGFPGSSGPRGDPGFKGEKGDIGLPGKPGSMDELRMDSMKGQKGEQG
EKGQVGPSGDKGARGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVG
GMGMPGVPGEKGVPGIPGPQGLPGSPGEKGTKGEKGQAGLPGIGIPGLPGAKGDQGLAGF
PGSPGEKGEKGSSGLPGMPGSPGPKGSPGNVGYPGSPGLPGEKGDRGPPGLDGIPGIKGE
PGLPGQPGPTGPAGQKGEPGSDGIPGSAGEKGEPGVPARGFPGFPGSKGEKGSKGEVGFP
GLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGAPGRPVEGPKGDRGPQGQPGLPGPPGPMG
PPGLPGLDGLKGDKGSPGWPGTPGVPGPKGDPGFQGMPGIGGSPGITGAKGDMGPPGVPG
FQGLKGLPGIQGVKGDPGDQGFPGTKGLPGPPGPPGPYHVVKGEPGFPGPEGPAGMKGIQ
GPPGPKGQQGVTGSVGLPGPPGIPGFDGAPGQKGEPGPFGPPGPRGFPGPPGPDGLPGSM
GPPGTPSVDHGFLVTRHSQTTEDPQCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCL
RKFSTMPFLFCNINNVCNFASRNDYSYWLSTPAPMPMSMAPISGENIRPFISRCAVCEAP
AMVMAVHSQTIQIPPCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFI
ECHGRGTCNYYANAYSFWLAIIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5028 nt   +upstreamnt  +downstreamnt
atgagtggtgatgagcaggaatttctggggcagaatgttgatacctccaacacctgctgt
cgagagtggcttcgaactctcaaccctgtcatcatccagggtggtggttgtgctggctct
ggctgtgggaaatgtgactgccacggagtgaagggacaaaagggtgaaagaggcctccca
gggttacaaggtgtcattggatttccaggaatgcaaggccctgaggggccgcagggacca
cctggacaaaagggtgacactggagaaccagggctgccaggaacaaaagggacaagggga
cctccaggagtatcgggctatcctggaaacccgggacttccgggtattcctggacaagat
ggcccacccggtcccgcaggtatcccaggatgcaacgggacaaagggtgaaagagggcct
ctgggacctcctggtctgcctggattcactggaaatcctggaccgcctgggttaccagga
atgaagggggatcctggtgaaataatcggccatgtgcccgggatgctgttgaaaggtgaa
agaggatttcctggacatccaggaataccaggtatgccaggattgcccgggctacagggt
cccgttggccctccaggatttactggaccaccaggtcctccaggccctcctggccctcca
ggtgaaaaggggcaaatgggcttaagttttcaaggaccaaaaggtgacaagggtgatcaa
ggggtcagtggacctccaggagtgccaggacaagcccaagttcaagaaaaaggagacttt
gccactaaaggagagaagggtcaaaaaggtgaacctggatatcagggagtgccagggttt
ggagagaaaggtgaacctggaaaaccaggacctcgaggaaaacctggaaaagatggtgaa
aaaggagaaaaagggagtctagggtttcccggcgatgtggggttgccaggactcccgggc
cgagagggtttaaagggagacaaaggtgaagcaggccctccgggcccacctggcactgtc
attggcccaggaatcttgggagaaaaaggcgaacgggggtacccagggtctccagggttg
agaggagagccaggccccaaaggttacccaggattacaaggccagccagggcccccaggt
atctcgatacccgggcagcctggtgttcctggcttccctggtgaaagaggagaaaaaggt
gaccaaggacttccaggggtgtctctgccaggaccaagtggaagagatggactcccaggc
cctcctgggccccctggacctcctggacagccaggccacacgaatggaattgtggaatgc
cagcctggacccataggtgatccgggtcctcccggaactccagggcacccaggattggca
ggcgaagttggagagaaaggtcaaaaaggagacagttgccttgtctgtgacacagcagga
cttcgtggaccccctgggccccagggacccccaggagaaacaggtttcccaggacagcca
ggggccaagggtgaaaaaggtttacctggcagggatggtctagaaggcttgcccggccct
caaggtacaccagggctgatgggccagccaggagccaagggagagcctggtgagatttac
tacgacgttcaactcaaaggtgacaaaggagacccaggtttcccaggacaacctggtata
ccaggcagagcaggagctcctggaagagatggccatccaggtctgcccggccccaaaggc
tccccgggtttaataggattaaaaggagaccgtggccccccaggaggggttggatttccc
ggcagtcgtggtgacatcggccctcctgggcctccagggtatggaccaataggccctgtt
ggtgacaaaggacaagcaggccttccaggaaatcctggatccccaggccagccaggtctc
aggggtgaagcaggaagagtcatgcctttacctggtcctcctggagcagacggacttcca
ggttccccaggtttccaaggacctcaaggtgatcgaggtttccctggaaccccgggaagg
cctggcctcccaggagagaggggtgctgttggccagccagggattggattcccaggacct
ccaggccccaaaggtgttgatggcatacccggagatgtgggacttcctgggaatccaggt
cgcccgggacctaatggcttacctggcaacccaggtttacctggccaaaagggagagcct
ggagttggtctgccaggactcaaaggattgccaggtcttccaggcattcccggcacacct
ggggagaagggaagcatcgggggaccaggcattcctggagagcatggagcaatcgggccc
cccggccttcagggaagcagaggtgacccaggacctcctggattgcaaggtcccaaagga
gccccaggagtccctggaataggtccccctggagtgatgggcccccctggaagacaggga
caaccagggtcatcaggccctcctggagtgaaaggagagaaaggcttccctggattccca
ggcctggacatgccgggccccaaaggagataaggggagtcaagggctccccggtctaaag
ggacagtcagggcctcctggttttcctggacagcagggggcaccaggacttcctggggtt
caaggtctcaagggagagatgggagtcatggggacccccggacagcctggttctccagga
cgagtgggcctgccaggattgccgggtgaaaaaggggaccatggctttccaggctcttca
ggacccaggggagaccctggattcaagggggaaaaaggagatattggtctacctggcaag
cctgggtccatggatgaactgcgcatggacagcatgaagggtcagaagggagagcaagga
gaaaaaggacaagttggaccaagtggtgataaaggagctcgaggagaccctggaactcca
ggagtgcctggaaaagacggccaagcagggcaacctggccagccaggacctaaaggtgat
ccaggcataagcggaaccccaggtgctccaggacttcctggaccaaaagggtcggttggt
ggaatgggcatgccaggagtacctggagaaaaaggtgtgcctggaattcctggccctcag
gggctccctggctcacctggggagaaaggaacaaaaggggagaaagggcaggcaggccta
cctggcattggaattcccggactgcctggggcaaagggagatcaagggttagcaggtttt
ccagggagtcctggagagaagggagaaaaaggaagcagtgggctcccaggcatgcccggg
tctccaggccccaaaggatcaccaggaaatgttggctatccaggaagccctgggttgcct
ggagaaaaaggtgacagaggccccccgggactggatggcattcccggcatcaaaggagaa
ccaggtcttcctgggcagcctggcccaacaggcccagccggccagaaaggtgaacctggc
agtgatggaattccagggtcggcaggagagaagggtgaaccaggtgtacctgcaagagga
ttcccagggtttccagggtccaaaggagagaaaggttcaaagggtgaggtgggtttccca
ggattagctgggagcccaggaattcctggatccaaaggagagcaaggattcatgggtcct
ccggggccacaaggacagccaggattgcctggtgctccaggccgccctgtggaggggccc
aaaggagaccggggtccacagggacaacctggcctgccaggacctccgggaccaatgggg
cccccggggctccctgggcttgatggattgaaaggtgacaaaggaagcccaggctggcca
gggactcctggtgttccaggacccaagggagaccctggattccaaggcatgcctgggatt
ggtggctctccaggaatcacaggtgctaagggtgatatgggacctccaggagttccaggc
tttcaaggtctgaaaggtctccctggcattcagggagttaaaggagacccaggagaccaa
ggtttccctggaactaaaggtcttccaggtccccccggaccgccaggtccttatcatgtc
gtcaaaggggagccagggttccctggtcctgagggtcctgctggtatgaaagggattcag
ggacctccaggccccaaaggacagcaaggtgtgacaggatcagtgggcttacctggacca
ccaggtattcctgggtttgatggtgcccctggccagaaaggggagccgggaccctttgga
cctcctggtccaagagggtttccgggaccgccaggccctgatggtttgccaggatctatg
ggtcccccaggcaccccatctgttgatcacggtttccttgtgaccaggcacagtcaaaca
acagaagatccacagtgtcctcctgggaccaaaattctttaccacgggtactctttgctc
tatgtgcaaggcaatgaacgggcccatggacaggacttaggcacggctggaagctgcctg
cgcaagttcagtacgatgcccttcctgttctgcaatatcaacaatgtctgcaacttcgcc
tcccgaaatgactattcctactggttgtccactccagcgcccatgccaatgtctatggca
cccatctccggggaaaatattagaccgtttattagcaggtgtgcagtgtgtgaggcacca
gccatggtgatggcagtacacagccagacgattcagatcccaccgtgccccaatgggtgg
tcctcactctggattggctattcctttgtgatgcacaccagcgctggagccgaaggttct
ggccaagccctcgcatcccccgggtcctgtctggaagagtttagaagtgcgccattcatc
gagtgccacggccgtgggacttgtaattactatgcaaatgcttacagcttttggcttgcc
attatagagagaagtgagatgttcaagaagcccacgccgtccaccttgaaggctggggag
ctgaggacgcatgtcagtcgctgtcaagtctgtatgagaagaacataa

KEGG   Desmodus rotundus (common vampire bat): 112322610
Entry
112322610         CDS       T05907                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112322610 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112322610 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112322610 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322610 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112322610 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112322610 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112322610 (LAMA1)
   05414 Dilated cardiomyopathy
    112322610 (LAMA1)
   05416 Viral myocarditis
    112322610 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112322610 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112322610 (LAMA1)
   05145 Toxoplasmosis
    112322610 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_N Laminin_I Laminin_II Laminin_G_3
Other DBs
NCBI-GeneID: 112322610
NCBI-ProteinID: XP_024435952
LinkDB
Position
Unknown
AA seq 3149 aa
MDVHLESNLSVHPQFEYSSAHCSEELWDLQSLLSKKCCVGSLGVWTQKLKEGLTSSYMQI
RPFKLLTPSGRKPESGENSRERLVLGCSLGTKNGACLFPAILNLASNAHIITNATCGEQG
PEMFCKLVEHVPGRPVRNPQCRVCDGNSANPKERHPISNAIDGTNNWWQSPSIQNGREYH
WVTITLDLRQVFQVAYVIIKAANAPRPGNWVLERSLDGTKFSPWQYYAVSDTECLTRYNI
TPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIR
LRLQRIRTLNADLMTLSHRDPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETA
QKLQCRCEHNTCGESCSRCCPGYHQQPWRPGTISSGNMCEECNCHNKAHDCYYDESVANE
KKSLNMAGQYQGGGVCINCLQNTMGINCETCVDGYYRPHKVSPYDDNPCHPCGCDPFGSL
GSVCIKDDLHSDLHKGKWPGQCPCKEGYAGGKCDRCQFGYKGYPACARCDCGPAGSVNED
PCSEPCLCKENVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSDVCDSLSWPISQVKDM
SGWLVTDLATTNKIPSQRDALGGRHQISINNTVVMQQLTSKYYWSAPEAYLGNKLTALGG
SLRFTVSYDIPVETVDSDLVSHADVIIKGNGLTLSTQAEGLTLQPYEEYLNVVRLVPENF
RDFNSKREIDRDQLMTVLANVSHLLIRANYNSAKMALYRLDSVSLDTASPNVIDLALATE
VEHCECPPGYAGISCESCLPGYYRVDGILFGGICQPCECHGHAAECDIHGVCFACEHNTT
GDHCEQCLPGFYGLPVRGTPGDCQPCACPLSSASNNFSPSCHLDDADEVVCDQCALGYSG
TWCERCADGYYGNPTVPGESCVPCNCSGNVDPLEAGHCDSVTGECLRCIGNTDGAHCERC
ADGFYGDAVTAKNCRACACHGKGSLSDVCHRETGLCNCKPHVTGQWCDQCLRGYYGLDTG
LGCLPCSCSPSGSMSGDCTEEGQCPCIPGVAGKRCDRCARGFYAFQDGGCTACDCAHTQN
SCDPHSGACICPPHTQGVTCEECEDGYWGYDLELGCQACNCSGEGSASHRCDVLTGHCQC
KPAFGGLSCDQCSLGFRDFPDCVACDCDVRGTLVDTCEEEQGLCSCAQETGTCSCKENVL
GLQCSECRAGTYALHADNPLGCTACFCFGLSQLCSEVEGYVRMPVTLGSDQPLLRVVSQS
NLRGTTRGVYHQAPDVLLDAVTVRQHVHAEPFYWRLPGQFQGDQLMAYGGKLKYSVAFYS
AHGVGTFNLEPQVLIRGGRTRKQVIYMDAPAPENGVRQEQAVEMKENYWKYFNSVSEKPV
TRSDFMSVLSNIEYILIKASYGQGLQQSRISNISMEVGRKADEQPPGREGASLLEKCLCP
PGTAGLSCQNCAPGYYRGKLPQGADRGPRLLLAPCVPCSCNNHSDICDPETGTCLNCSHN
TSGDHCDVCAPGYYGKVTGSATDCSLCACPHSRPASFSPTCVLEGDRDFRCDACVLGYEG
QYCERCSSGYHGNPQKPGGTCQSCDCSPHGSVHRDCDRGSGQCVCRPGAAGLRCEECEPR
HILVESNCISCDDECTGVLLSDLDNTDDTILSVNLTGMFPAPYGILSNLENTTKYLRESL
LKENTQKELGKTQLEGVTEQTDGLQRELTRVLTSSQHVARATERILDKSQALMTLTEKLK
MSIQEIIEKATTLNQTLDEDFQPSSSTLQNMQRNITSLLETIQKRRFMQLHQNATLELKS
AKDLLSQIQKNYQKPQNKLKVIKEAASSLLSKHNSELQAAEDLMREAEAKTQESNRLLLI
VNANLQEFSDKKLLVQEEQNLTSVLIAKGIRLLDAATAQAKAARSALAQLEHHRDELLLW
TAKIRHHVDDLVMQMSKRRVLTLVYRAEDHAAELQRLAGALDSGLGSTQHVSLNATRATH
AHSNIQSLIEESEKLAKAALRTVTEASLSSESLVSDGRAALQRSSKFLKEGKSLSRKHQG
LALELRELRNTANTFQENAGKITRQTNESLLILRAIPEGVRDKGTKIKEVALSANQSAAS
TLKNVVGLSQKLLNTSTDLSRVNATFRETNELLWDSSMTSLLAGRKVKDVETQANLLFDR
LKPLKILEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYRPPISSTNYNTLTL
NVKTSEPDNLLFYLGSSTSPDFLAVEMRRGKVAFLWDVGSGPARLEFPDFSIDDDRWHSI
YITRFGNTGSVTVKEMSATQEPRPKTSKSLGSANVLDINNSTLMFVGGLAGQVKKSPAVK
VTHFKGCMGEAFLNGQSIGLWNYIEREGKCHGCFGSPQNEDSSFHFDGSGYSVVEKTLRA
TVTHIIMLFSTFSTNGLLLYLTSNGTKDFLSIELVHGRVKVTIDLGSGPLALVTDQRYNN
GTWYKIAFQRNRQQGLLAVIDAYNTSYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRV
VRKGVTSKSYVGCIKNLEISRSTFDLLRNSYGVRKGCILEPIRSASFLKGGYVELPPKSL
SPESELLATFATMNSSGIILAALGKRGENQQAHGPFFSIMLIEGHVEVHVNSGDGASLRR
ALLQAPMGTYGDGQEHSISLIRSGRIITVQLDETNPVEMNLGPSVESTTINVSNLYVGGI
PEGEGAVMLRMRRSFHGCIRNLVFNMELLDFSHAVGYEQVDLDTCLLSERPKLAPHGVDS
ELPPEPQPLPSPQQCAVDGAPEFVRDALQFGLAHSSHLVLPFNQLAVRKRLSVQLRIRTF
ASSGLIYYMAHQNQVDYAALQLHGGHLHFMFDLGKGRTKVSHPALLSDGKWHMVKTEYFK
RKGFVTVDGQESPTVTTVGDGTALDVEGKLYLGGLPSDYRSRNVGIITHSIPACIGEVTV
NSRQLDKDSPVSASAVAKCYAAAQEGTFFEGSGYAALVKEGYKVRSDVNITLEFRTSSEN
GVLLGISSAKVDAIGLEIVSGKLLFHVNNGAGRITATYEPRATNSLCNGKWHALQANKSK
HRVELIVDGDTVCAESPHVQSTSVDTNNPIYVGGYPADVKQNCLSIRTPFRGCLRKLTLT
KGPQVQSYDFSRAFDLQGVFPHSCPGTEP
NT seq 9450 nt   +upstreamnt  +downstreamnt
atggatgttcaccttgaatcaaacctcagtgtacatcctcagtttgagtactcgtcagcg
cactgcagtgaagaactctgggatctgcagtccctgctttcaaagaagtgctgtgttggc
agtttgggagtgtggacccagaagttgaaagaaggactgacatcctcttatatgcaaatt
aggcccttcaagttgctgactccttcagggcgaaagcctgagtctggagaaaacagcagg
gagaggttggtgctggggtgctcactgggaacgaagaatggggcgtgcctgttccctgcc
attctcaatcttgccagcaatgctcacatcatcaccaatgccacctgtggtgagcagggg
cccgagatgttctgcaaacttgtggagcacgtgcccggtcgacctgtgcggaacccccag
tgccgggtctgtgacggcaacagcgccaaccccaaagaacgccatccaatatcaaatgca
atagatggtaccaataactggtggcaaagtcccagtattcaaaatgggagagaatatcac
tgggtcacaatcactctggacttaagacaggtctttcaagtcgcctatgtcatcatcaaa
gctgctaatgcccctcgacccgggaactgggttttggagcgttccctggatggcaccaag
ttcagtccctggcagtattatgcagttagtgacacggagtgtttgactcgttacaacata
accccaaggcgggggccacccacttacagggctgatgacgaagtgatctgcacctcgtat
tactctaggctggtgccccttgagcatggagagattcatacatcactaatcaacggcaga
ccaagtgctgatgatctttcccccaagttgttggaatttacttccgcacgatatatccgc
cttcgcttacaacgcattagaacactcaacgcagatcttatgaccctgagccaccgtgac
cccaaagacctcgatcccattgttacaagacgatactactattcaataaaagacatttct
gttggagggatgtgtatctgttacggccatgccagcagctgcccgtgggatgaaactgca
cagaaactacagtgtcgatgtgaacataacacctgtggagagagctgcagtaggtgttgc
cctggataccaccagcagccctggagaccagggaccatttcttctggtaacatgtgtgaa
gaatgtaattgccacaataaagcgcatgactgttactatgatgaaagtgttgcaaatgag
aagaaaagtttgaatatggctggacagtaccaaggaggaggggtttgcataaattgcctg
cagaacaccatgggaatcaattgtgaaacctgtgtcgatggatattacagaccacacaaa
gtgtctccttatgatgacaacccttgccacccctgtggctgtgaccctttcgggtccctc
ggttctgtctgtataaaggatgatctccattctgacttacacaaagggaaatggccaggt
cagtgtccatgcaaagaaggttacgcaggaggaaaatgcgatcgctgccagtttggctac
aagggttacccagcctgtgcccgctgtgactgtggtccagctggcagtgtgaacgaggac
ccatgctcagagccttgcctctgtaaggaaaatgttgaggggaaaaattgtgatcgctgc
aagccaggattttataacttgaaggaaagaaaccccgagggctgctctgagtgtttctgc
tttggcgtttccgatgtctgcgacagtctttcctggcccatcagtcaggtgaaggatatg
tctgggtggctggtcaccgacttggccactacaaataagatcccatctcagcgagatgca
ctgggtggacgtcatcaaatcagcatcaacaacacggtggtcatgcagcagctgacttcc
aagtattactggtcggccccggaggcctatctgggaaataagctgacggcgctcggcggg
tccctgaggttcacagtgtcttacgatattccagtggagacagtggacagtgacctcgtg
tctcatgctgacgttatcatcaagggaaatggactcactttaagcacccaggctgagggc
ctgacactgcaaccctacgaagagtacttgaacgtggtgagactcgtgccggagaacttc
cgagattttaatagcaaaagggagatagaccgagatcagctgatgaccgtccttgccaac
gtgtcgcatctcttgatcagagccaactacaattctgcgaaaatggctctttataggttg
gattccgtctctctggacacagctagccctaacgtcatagacctggccctggccactgag
gtggagcactgcgaatgtcccccaggctatgcagggatctcctgtgagtcctgccttcct
ggctattaccgtgtggatggaatactctttggaggaatttgtcagccctgtgaatgccat
ggccatgcagctgagtgtgatattcacggcgtttgctttgcatgtgagcacaacaccacc
ggggaccactgtgagcagtgcctgcccggcttctacgggctgcctgtccgagggacgcct
ggggactgccagccgtgtgcctgccccctctcctcagcctccaacaatttcagccccagc
tgccacctggacgacgcagatgaagtggtctgtgaccagtgtgccctgggatactccgga
acttggtgtgagagatgtgccgatggttactatggaaacccaacagtgcctggggaatcc
tgtgtcccctgtaactgtagcgggaatgttgaccccttggaggccggccactgtgactcc
gtcactggagaatgtctgaggtgcattgggaatacagatggtgcccactgtgagaggtgt
gctgacgggttctacggggacgctgtgaccgctaaaaactgccgagcctgtgcatgccac
gggaagggctctctctctgacgtctgccatcgtgagaccggactgtgcaactgcaaacca
cacgtgactggacagtggtgcgaccagtgcttgcgtggctattacgggctggacacaggg
cttggctgcctgccctgtagctgcagcccatcgggctccatgtcgggtgactgcacggag
gaaggccagtgtccctgcattccaggtgtagctgggaaaaggtgcgacaggtgtgcacgt
ggcttctatgcattccaggatggtggctgtacagcctgtgattgcgctcacactcagaat
tcatgtgacccgcactcgggggcgtgtatctgcccacctcatactcaaggcgtaacgtgt
gaagaatgtgaggacggatactggggctatgacctggagctcggatgccaggcctgcaat
tgcagtggtgaagggtcagccagtcaccggtgcgatgtgctcactggccattgccagtgt
aagcctgcatttggtggcctgagctgcgaccagtgctccctgggtttccgggactttcca
gactgtgtggcctgtgactgtgacgtgagagggacactagtggacacctgtgaagaggaa
cagggtctttgcagctgtgcacaggaaactggcacctgctcttgcaaggaaaatgtcctt
ggccttcagtgcagcgagtgtcgagctggcacctatgccctccacgccgacaaccctctg
gggtgcaccgcatgcttctgctttgggctgtctcaactctgctcagaggtggagggttat
gtgaggatgccagtaacgctgggctcagatcagccccttctgcgtgtggtttctcagagt
aacctcaggggcacgacccgaggggtgtatcaccaggcccccgatgtcctcctggacgcc
gtgaccgtcaggcagcatgtccacgcggagccgttttactggcggttgccagggcagttc
cagggcgaccagctcatggcttatggcggcaaactgaagtacagtgtggccttctactcc
gcccacggtgtgggcaccttcaaccttgagcctcaggtgctcatcagaggaggccggacc
agaaagcaagtcatttacatggatgcacccgcaccagagaatggagtgagacaagagcaa
gcagtagaaatgaaagagaattattggaaatattttaattctgtttctgaaaaacctgtc
acacgctcagattttatgtctgttcttagcaacatcgagtacatcctcatcaaagcatcg
tatggtcaagggttacagcaaagcaggatctcaaacatttccatggaggtcggcaggaag
gccgacgagcaacccccaggcagggagggggcctcgctgttggagaagtgcctctgtccg
cccggcacggctggactctcatgtcagaactgtgcacctggttactacagagggaagctt
ccgcagggtgctgacaggggacctcgccttctgcttgctccttgtgtgccctgcagttgt
aacaaccacagtgacatctgtgacccagaaacggggacatgtctgaattgcagccataac
acctccggtgaccactgtgatgtgtgtgctcccgggtactacgggaaggtgactggctca
gccactgactgctctctgtgcgcctgtcctcacagccgccctgcaagtttcagtcccact
tgtgttttggaaggtgatcgtgatttccgctgtgatgcctgtgttctgggctatgaagga
cagtactgtgagaggtgctcgtcaggctatcatgggaaccctcaaaagccaggtggcacc
tgccagagctgtgactgcagcccgcatggctctgttcaccgtgactgcgaccgcggatct
gggcagtgtgtctgcaggccaggggccgcggggctccgatgcgaggaatgcgaacccagg
catattctggtggaaagcaattgtatttcttgtgatgatgaatgtacaggtgtgctgctg
agtgacttagacaataccgatgatactattctttctgtgaacctcaccggcatgttccct
gccccgtatggaattttgtcaaacctggaaaatacaactaaatatctccgggaatcttta
ttaaaagagaatacgcaaaaggaactggggaaaactcaacttgaaggtgttacagaacaa
acagatggcctgcaaagggagctcactagagtgttaacaagtagccaacatgtggccaga
gcgactgaaagaatcctcgacaagagtcaagctctcatgacacttactgagaaactgaag
atgagcattcaagaaattattgaaaaggcaacaactctaaatcagaccttggatgaagat
ttccagccatctagctccactcttcagaatatgcaaaggaacattacatctttgctggaa
accatacagaaaaggcgtttcatgcagttgcaccaaaatgccacccttgaactaaagtct
gcgaaagatttgttgtcacaaattcagaaaaattaccagaagccacagaataagttgaag
gtgataaaagaagcagcaagcagcctcctttcaaaacacaacagtgaactgcaggcagca
gaagacctcatgagggaagccgaggcaaagacgcaggaaagcaaccgcctgctgctcatt
gtcaatgccaaccttcaagagttcagtgataaaaagttgcttgttcaggaagaacaaaac
ttaacctcagtgctaatcgccaaaggaataagattgctcgatgctgccactgcacaagca
aaggctgcacgaagtgctctagcacagctagagcatcaccgggatgagctacttctgtgg
actgccaaaatcaggcaccatgtggatgatctggtcatgcagatgtccaaaagaagagtg
cttacccttgtctacagagctgaggatcacgcagctgagctccagagattagcaggtgcc
ctggacagcggccttggaagtactcaacatgtgtccctgaatgcaacccgtgcaacccac
gcccattccaacattcagagcctcattgaagaatcagaaaaactggcgaaggccgctctc
aggaccgtgactgaggcgagcctgtcctcagaatccctggtgtctgacggcagagcagct
ctccagcgcagttccaaatttctaaaagaaggcaagagcctgagcagaaagcatcaaggt
ctcgcattggaactgagagaactgagaaatacagcaaacacatttcaagaaaatgctggc
aaaattactaggcagaccaatgaatcactcttaatacttagagcaattcctgaaggtgtc
agagacaaaggaaccaaaatcaaagaggtggccctatctgccaatcagagcgctgcgagc
accctaaagaacgttgtgggcctgagtcagaagctgttgaacacatcgacggacctgtcc
agggtcaatgccacattccgagaaacaaacgagctcctatgggattcctcaatgaccagt
ctgttagctggaagaaaagttaaagatgtggaaacacaagccaaccttttatttgatcgg
ttgaagcctttgaagatattagaagagaacctgagcagaaacctgtcagaaattaaactg
ctgatcagccaggcccggaaacaagcagcttccattaaagttgctgtgtctgcagacaga
gattgtatccgagcttaccggcctcctatctcttcaactaactataacaccttaacactg
aatgtgaagaccagcgaacccgataacctcctcttctacctgggcagcagcaccagccct
gacttcctggcagtggagatgcggcgagggaaggtggccttcctctgggatgtgggctcc
gggccagcacggttggaatttccggacttctcgattgatgatgacagatggcacagtatc
tacataaccagatttggaaacactggttcagtgactgtgaaggaaatgagtgcaactcag
gagccacgaccaaaaacaagtaaatccttagggtctgctaacgtcctggatataaacaac
tcaacactcatgtttgttggggggctcgcaggacaagtcaagaagtctcctgctgtgaag
gttactcatttcaaaggctgcatgggagaggccttcctgaatggacagtcgatcggccta
tggaactatattgaaagggagggcaagtgccatggctgcttcggaagcccccagaatgaa
gactcttccttccattttgacgggagtgggtattctgtcgtggagaagacgcttcgggct
actgtgacacacataattatgctttttagtaccttttcaacaaatgggcttcttctctac
ctcacttcaaatggcaccaaagactttttatccattgagctggtccatggcagagttaaa
gttacaattgacctgggctcagggcctcttgcccttgttacagatcaacgttataacaac
ggaacctggtacaaaattgccttccaacggaaccggcagcaaggactcttagcagtcatt
gatgcttataacaccagctacaaggaaaccaagcaaggggaaaccccaggagcatcttca
gacctcaaccgtctggataaggatccaatttatgtgggtggattacctaggtcaagagtt
gtgaggaaaggtgtcaccagcaaaagctatgtgggctgcatcaaaaacctggaaatatcc
agatcaacctttgatttactcagaaattcctacggcgtgagaaaaggctgtatactggag
cctatccggagtgctagcttcttgaaaggcggctatgttgagttgccacccaagtctttg
tcgccagaatcagaattgttggcaacatttgccaccatgaacagcagtggcatcatcctg
gctgccctgggcaagcgtggggagaatcagcaggcccatgggcccttcttttccattatg
ctcattgaaggccacgttgaagtgcatgttaactctggggacggagcaagcctgagacga
gctctcctgcaggcccccatgggcacgtacggcgacgggcaagagcactccatctccttg
ataaggagcgggagaattatcactgtccaactggatgagacaaatcctgtagaaatgaac
ttgggcccatcagtggaaagcacgacaataaatgtgtccaacctgtacgtagggggcatc
ccagagggtgagggggcggtgatgctcaggatgagaagatcgttccacggctgcatcaga
aacctcgtctttaacatggaacttttggacttctctcatgcagttggctatgaacaagtg
gacttggacacttgcttgctgtcagaaaggcctaagctggctcctcatggagtggacagc
gagctcccgccagagccccagcctttacccagtccgcaacagtgtgctgtggacggagcc
cccgagtttgtccgcgacgctctccagtttggcctcgcacacagcagccacttggtgctg
cctttcaatcagttggctgtcagaaagaggctctcggttcagctaaggatccgaacattt
gcctccagtggtctgatttactacatggctcaccagaaccaagtggattacgctgcactc
cagctgcacgggggccacctccacttcatgtttgatctcgggaaaggaaggacaaaggtc
tctcaccctgcactgctcagtgatggcaagtggcacatggtcaagacagagtactttaaa
agaaagggcttcgtgacggttgatggccaggaatcccccacggtgaccacagtgggagat
ggcactgccttggacgtggagggaaagttgtacctgggaggccttccctctgattacagg
tccaggaacgttggaattatcacccacagcatccctgcttgcattggcgaggtgactgtg
aacagcaggcagctggacaaggacagcccagtgtcggcttctgcagtagccaagtgctat
gcagcggcccaagaaggaactttctttgaaggaagtggatatgcagctcttgtcaaagaa
ggctacaaagttcgatcggatgtaaacatcacacttgagtttcgtacctcctcagagaac
ggcgtcctcctggggatcagcagcgccaaagtggatgccattgggctggagattgtgagt
ggcaagctcttgtttcatgttaacaacggtgccggcaggataacggccacatatgagccc
agagctaccaacagcctctgcaatgggaagtggcacgccctgcaagctaacaaaagcaaa
caccgcgtggagctgatcgtcgacggtgacaccgtttgtgctgaaagtccacacgtccag
tccacctcggtggacaccaacaatcccatttatgttggcggctatcctgcggatgtaaag
caaaactgcctgagcatccggacgcccttccggggctgtctgaggaagctcactctgacc
aagggcccgcaggtgcagtcctatgacttcagcagagcttttgacctacagggagttttc
cctcattcctgtcctgggactgagccctga

KEGG   Desmodus rotundus (common vampire bat): 112322675
Entry
112322675         CDS       T05907                                 

Definition
(RefSeq) laminin subunit alpha-3-like
  KO
K06240  laminin, alpha 3/5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112322675
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112322675
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112322675
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322675
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112322675
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112322675
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112322675
   05145 Toxoplasmosis
    112322675
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_EGF Laminin_G_3 Spc7 DNA_photolyase
Other DBs
NCBI-GeneID: 112322675
NCBI-ProteinID: XP_024436004
LinkDB
Position
Unknown
AA seq 1726 aa
MPPAVRWSARSAGWLWIFGAALGQCLGYNSQQQRVTFLQSPGQSNLQSSYVEFKPSQGCS
PGYYRDNKGAYTGRCVPCNCNGHSNRCQDGSGICINCQHNTAGDHCERCKEGYYGNAIQG
SCSVCPCPHSNSFATGCVVTGRSVQCSCKPGYTGAQCERCAPGYFGNPQKFGGSCQPCNC
NSNGHLSSCDPLTGDCINQEPKDSGPGEECDDCDSCVMTLLNDLATMGNELRQVKSQLQG
LSVSADTLEQMGHLETQTKDLRNQLLNYRSAISSQGSKVVGLEEELSNLNREFDALQEKV
QMNSRKAQTLYDNIDRTTQSAKELDTKIKNVIRNVHILLRQISGTDGGGNNLPSGDLPRK
LAEAEHMLRELRNRNFGKHLREAEAEKREAQLLLNRIRSWLETHQMENNGLAKSIQDALN
DYEAKLTGLRTTLQDTTAQAKKATGLNQNNERTLESLKRQVKEMNSLQSGFTKSLATADS
SLLQTNVLLQLMEKSQEEYKILAATVHEVRRELSDKVTELSKSAEKAPLVAAAEEHAQSL
QELAKQLEEIKRNTSGDDLVLRAVDAATAYDNILNAIKAAEDAADKATSASESALQTVIK
EDLPRKAKTLSSDSDKLLKEAKITQKKLHQEISPALNKLQQTLKIMTVQKGVIDTNITTI
RDDLRGIERDDINGMIDSAKSMVRNANDITDEILDGLNPIQTDVERIKETYGRTQSEDFN
KALTDADNSVKKLTNKLPDLLSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAI
PMRFNGKSGVEVRLPSDLEDLKGYTSLSLFLQRPESGENGRTENMFVMYLGNKDASRDYV
GMAVEDGQLKCVYNLGEREAELQVDQILTKSETQEAVMDRVKFQRIYQFAILNYTTQATS
NKPETPRLHDMDSGSSNTLLNLDPEDVVFYVGGYPPDFTPPARIRFPLYRGCIELDDLNE
NVLSLYNFRKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTVPNAPFPTFVQTIQTT
VDRGLLFFAENQDRFISLNIEEGRLVVQYKLNSEPPEEKGVGDIINDGNDHSIQIRIGKT
QRSMRINVNSKNIKIEGEIFDFNTYYLGGIPLSIRERFNISTPAFRGCMKNLKKTTGVVR
LNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLDSPLPSQFQASFGFQTFQPSGTLLSH
LAGTSSLHVTLEDGHIELSTRDSSGPIFKSPQTYRDGLLHYVSVISDNSGLRLLIDDQLL
KSNQRLQGSSSSQKSLHLGGSNFEGCISNVFFLRLSQSPEVLDLATKSFQKDVSLGGCSL
NKPPFLMLLQGSTRFNRAKIFNINQPMQDTPVASPRSVQMWQNAQSCPSPPRTHASHGAL
RFGDSPTSHLIFMLPPELLKPRPQFAVDVQTTSSRGLVFYTGTKNSFLALYLSKGRLVLA
LGTDGKKLRLKSKMKCNDGKWHTVSFGQDGEKWRLVVDGLRAWEASWPGIPTFSLQTPVS
LGSSPSGKPKSLPQKSFVGCLRNFQLDSKPLDTPSESFGVSPCLIGSLEKGIYFSQEEGH
IKLANSVLLGPEFKLLFSIRPRSLTGILIHIGSQPGRHLCVYMEAGKVMASVDSEAGGIL
TSVTPKQSLCDGQWHSVAVTIKQHILHLELDADNSYTAGQLPFPPASTQEPLYIGGVPAD
LKTLKLPVWESFFGCLKNIQVNHIPIPVTETVEVQGTVSLNGCPDH
NT seq 5181 nt   +upstreamnt  +downstreamnt
atgcccccagcagtgaggtggtcagcccgaagtgcggggtggctgtggatctttggggca
gccctggggcagtgtctgggatacaattcacagcagcaaagggtaacctttcttcagtct
cccggtcaaagtaatctgcaatcaagttatgtggagtttaaacccagccagggttgtagc
cctggatactatcgggataacaaaggcgcgtatactggacggtgtgttccctgcaattgc
aacggacattccaaccgatgccaggatggctctggaatatgtattaattgccagcataac
actgcgggggaccactgtgagcgctgcaaagagggttactatgggaatgccatccaggga
tcctgtagtgtctgcccatgtcctcattcaaacagttttgccaccggctgtgttgtgacg
gggagaagtgtgcagtgctcctgtaaacctggatacacaggagcccagtgtgaaaggtgt
gccccaggatattttgggaatccccagaaatttggaggaagctgccagccatgcaattgt
aatagcaatggccacttgagcagttgtgaccccctgactggagactgcattaaccaagaa
cccaaagatagcggcccgggagaagagtgtgacgattgtgacagctgtgttatgacactc
ttgaatgacctggccaccatgggcaacgagctccgccaagtcaagtctcagctgcagggc
ctgagtgtcagtgcggacactctagaacagatggggcacttggagacccagaccaaggac
ctgagaaatcaactgctcaactaccgttctgccatttcaagccagggctctaaagtggtt
ggcctagaagaagaactgagtaatttgaatcgtgaatttgacgctttgcaagaaaaggtt
caaatgaattcaagaaaagcacaaacattgtatgacaacattgatcggaccacccaaagc
gcaaaagagctggacacaaagattaaaaatgtcatccgaaatgtgcacattctcctaagg
cagatctctgggacagatggaggagggaacaacttgccttctggtgatcttcccaggaag
ttggctgaggcggaacacatgctcagggaactgcggaaccgcaacttcgggaagcacctg
agagaagcagaagctgaaaagagagaagctcagctcttgctgaatcggatcaggagctgg
ctggagacccaccagatggagaacaatggacttgctaagagcatacaggatgctttaaat
gactatgaagccaaactcactggccttcgcactacactacaggacacaactgcccaggca
aagaaggccactggcctcaaccaaaacaatgaaaggactttggaatccctcaagagacaa
gttaaagaaatgaattccctgcagagtggtttcaccaagtctctagccactgcagactct
tccttactgcaaaccaatgttttgctgcagctgatggagaaaagccaggaggaatataaa
atattagctgccactgtacatgaagtaagacgtgaactaagtgacaaagtgacagaactc
tccaaatccgccgagaaagcaccgctggtggcggcagcagaggagcatgcgcaatcctta
caggagctggcaaagcagctggaggagatcaagaggaacaccagtggggatgacctggtg
ctccgtgctgtggatgcggccaccgcctatgacaacatcctgaacgccatcaaagcggca
gaggatgctgctgacaaggccaccagtgcatctgaatctgccctccagacagtgataaag
gaagatcttccaagaaaagctaaaaccctgagttctgacagtgacaaactgttaaaggaa
gccaagataacacagaagaagctacatcaagaaatcagtccggctctgaacaagctacag
caaactctgaaaattatgacagttcagaaaggggtgatagacaccaatatcactaccatc
cgcgatgatcttcgtgggatagagagagatgatatcaatggtatgatcgatagtgcaaag
agcatggtcagaaatgccaacgacatcacagatgagattctggatgggctcaaccccatt
cagacggatgtggaaagaattaaggagacctatgggaggacacagagtgaagacttcaac
aaggctctcactgacgcggacaactcagtaaagaaattaaccaacaagctgcctgatctt
ttgagcaagattgaaagtatcaaccaacagctgttgcccctgggcaacatctccgacaac
gtggaccgcatccgagagctgattcagcaggccagagacgctgcgaataaggtcgctatc
cccatgcgattcaatggtaaatctggcgtcgaagtccggctgcccagtgacttggaagat
ttgaaaggctacacatctctttctttgtttctccaaagacctgagtcgggagaaaatgga
aggactgaaaatatgtttgtgatgtaccttggaaataaagatgcctctagggactacgtc
ggcatggcagttgaagacggccagctcaagtgtgtctacaacctgggggaacgggaggct
gaactgcaagtggaccagatcttgaccaagagtgaaactcaggaggcggttatggaccgg
gtgaaatttcagagaatttatcagtttgcaatacttaattacaccacacaagccacgtcc
aataaaccggaaacacctcgactccatgacatggacagtggaagtagcaacacactcctc
aatctggatcccgaagacgttgtattttatgttggaggttacccacctgactttacccct
cctgcaagaattagattccctctgtacagaggttgtattgaattagatgacctcaatgaa
aatgttctgagcttgtacaacttcagaaagactttcaatctcaatacaactgaagtggag
ccttgtagaaggagaaaggaagaatcagacaaaaattactttgaaggaacaggctatgct
cgagttccaactgtaccaaatgcccccttcccaacctttgtacagacgattcagaccact
gtggatagaggtttgctgttctttgcagaaaaccaggatcgcttcatctctctaaacata
gaagaaggccgtctcgtggtgcaatacaaactgaattcagagccaccagaagaaaaagga
gttggagacatcataaacgatgggaatgatcattcgattcagatcagaattggaaaaacc
cagagaagtatgcggataaatgtgaattctaaaaacattaaaattgaaggggaaatattt
gatttcaacacatattatctaggaggaattccactttccatcagggaaaggtttaacatt
tctacacctgctttccgaggctgcatgaaaaatctgaagaaaaccaccggcgtggtcagg
ttgaacgatactgtgggagtaacaaagaagtgctcagaagactggaagctcgtgcggtct
gcctcgttctccaggggaggacaattgagtttcaccgatttggactctccattgcccagc
cagttccaggcctcctttgggtttcagacctttcaacccagcggcacattattaagtcat
ctggcagggacaagcagcctccacgtcaccctggaagacgggcacattgaactcagcacc
agggacagcagcggcccgatttttaaatctccgcagacctacagggacggcttactgcac
tacgtgtccgtcatcagcgacaactctggactccggcttctcattgacgaccagcttctg
aaaagtaaccagaggctacaaggctcttcaagttcccagaagtccctgcatctgggcggg
agtaattttgagggctgtatcagcaacgtttttttcctgaggttatcacagagtcccgaa
gtcctagatttggccactaaatctttccagaaagatgtgtctctgggaggctgcagctta
aacaaaccaccttttctaatgttgcttcaaggttctacaaggtttaacagagccaagatt
ttcaatatcaaccagccaatgcaggacacaccagtggcctccccaaggagcgtgcagatg
tggcagaatgctcagtcttgcccatcacctcccaggacccacgccagtcatggagccctc
aggtttggggacagccccaccagccacttgatattcatgcttcccccagagttgctaaaa
ccaaggccacagtttgctgtggacgtgcagacaacatcctccagagggcttgtgttttac
acaggcaccaagaactcctttctggctctttatctctcaaagggacgtctggtccttgct
ttggggacagacgggaaaaagctgaggctcaaaagcaaaatgaagtgcaacgacgggaag
tggcacacggtgtcctttgggcaagatggagagaagtggcgcttggttgtagatggtctg
agggcctgggaggcaagttggcctggaattcccaccttcagcctccagacaccggtttcc
ctgggatcgtctccatcagggaagccaaagagccttccccaaaagagctttgtgggatgc
ctgaggaactttcagttggattcaaaaccactagacaccccttctgaaagctttggggtg
tctccctgtttgattggctctttggagaaaggcatttatttctcccaagaagagggtcac
atcaagctagctaactctgtgttgttggggccagaatttaagctccttttcagcattcgt
ccaagaagtctcactggaatcctaatacacatcggcagtcaacccgggaggcacctgtgt
gtttacatggaggcaggaaaggtcatggcctccgtggacagtgaggcaggcggcatcttg
acatcggtcacaccaaagcagtctctgtgcgatggacagtggcactcggtggcagtcacc
ataaagcaacacatcctgcacctggagctggatgcagacaatagctacacagcgggacag
ctccccttcccacctgccagcactcaggagccactatacatcggaggtgtcccagccgat
ttgaagacccttaagctccctgtctgggagtcattttttggctgcctgaagaatattcaa
gtcaaccacattcccatccctgtcactgaaactgtggaagtccaggggactgtgagtctg
aatggctgtcccgaccactga

DBGET integrated database retrieval system