KEGG   Desmodus rotundus (common vampire bat): 112296785
Entry
112296785         CDS       T05907                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05161  Hepatitis B
dro05162  Measles
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05215  Prostate cancer
dro05222  Small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112296785 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112296785 (CCNE1)
   04114 Oocyte meiosis
    112296785 (CCNE1)
   04115 p53 signaling pathway
    112296785 (CCNE1)
   04218 Cellular senescence
    112296785 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112296785 (CCNE1)
   05206 MicroRNAs in cancer
    112296785 (CCNE1)
   05203 Viral carcinogenesis
    112296785 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    112296785 (CCNE1)
   05215 Prostate cancer
    112296785 (CCNE1)
   05222 Small cell lung cancer
    112296785 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112296785 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112296785 (CCNE1)
   05161 Hepatitis B
    112296785 (CCNE1)
   05162 Measles
    112296785 (CCNE1)
   05169 Epstein-Barr virus infection
    112296785 (CCNE1)
   05165 Human papillomavirus infection
    112296785 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dro03032]
    112296785 (CCNE1)
   03036 Chromosome and associated proteins [BR:dro03036]
    112296785 (CCNE1)
DNA replication proteins [BR:dro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112296785 (CCNE1)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112296785 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112296785
NCBI-ProteinID: XP_024407333
LinkDB
Position
Unknown
AA seq 395 aa
MKEESGADVSAHSRKRKANVAVFLQDPDEEIGKIDKPERSQCGSQPWDDHAACENPCALI
PTPDKDQDELGYPSSANKPPIARPARASPLPMLNWANREEVWKIMLNKEKTYLRDKHFLQ
RHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQQDVVKTLLQLIGISS
LFIAAKLEEIYPPKLHQFAYVTDGACSGDDILTMELIIMKALKWHLSPLTIVSWLNVYMQ
VAYLNDLYEVLLPQYPQHVFIQIVELLDLCVLDVGCLEFSYGVLAASALYHFSSCELMQK
VSGFQWSDIEKCVKWMVPFAMVIRETGSSKLKQFRGVPAEDAHNIQTHLSSLDLLDKAQA
KKALLSEQNRLSPLPSGLLTPPPSGKKQSGDQDAA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaaggaggagagcggcgccgacgtctccgctcactccaggaagaggaaggcaaatgtg
gccgtatttttgcaggatcccgacgaagaaattggcaaaatcgacaagcccgagagaagc
cagtgcggcagtcagccttgggacgaccatgcagcctgtgagaacccgtgcgccctgatc
cccacgccagacaaagaccaggacgagctggggtacccgagctccgcgaacaagcccccc
atcgccaggccggcccgagcctcgcccctgcctatgctgaactgggcaaaccgagaggag
gtttggaagatcatgctgaacaaggagaagacgtacctgagggacaagcactttctgcag
cggcaccctctcctgcagccgaagatgcgagcgattctcctggactggctgatggaggtg
tgcgaagtctacaagcttcacagagagacgttttacctggcgcaggacttcttcgaccgg
tacatggccacgcagcaggacgttgtgaagacgctcctgcagctcatcggcatctcgtcc
ctgtttatcgctgccaagctcgaggagatctaccctcccaagctgcaccagtttgcttac
gtcacggacggggcctgttcaggagacgacattctcaccatggagctgatcatcatgaag
gctctcaagtggcacttaagtcccctgaccatcgtgtcctggctgaacgtgtacatgcag
gtggcctatctgaacgacctgtacgaggtgctcctgcctcagtatccccagcacgtcttc
atccagattgtggagcttttggatctgtgcgtcctggacgttggctgcttagagttttcc
tatggcgtcctggcggcttctgcgctgtaccatttctcctcgtgcgagctgatgcagaag
gtctccgggttccagtggagcgacatcgagaagtgcgtcaagtggatggtgcccttcgcc
atggtcatcagggagacgggcagttccaagctgaagcagttccggggcgttcctgctgaa
gacgcccacaacatccagacgcacctgagcagcttggacctgctggacaaagcccaggcg
aagaaagccctgctgtctgagcaaaacaggctttctcctctcccgtccgggctcctcacc
ccgccgccgagcggcaagaagcagagcggggaccaggacgcagcgtga

KEGG   Desmodus rotundus (common vampire bat): 112315543
Entry
112315543         CDS       T05907                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05161  Hepatitis B
dro05162  Measles
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05215  Prostate cancer
dro05222  Small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112315543 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112315543 (CCNE2)
   04114 Oocyte meiosis
    112315543 (CCNE2)
   04115 p53 signaling pathway
    112315543 (CCNE2)
   04218 Cellular senescence
    112315543 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112315543 (CCNE2)
   05206 MicroRNAs in cancer
    112315543 (CCNE2)
   05203 Viral carcinogenesis
    112315543 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    112315543 (CCNE2)
   05215 Prostate cancer
    112315543 (CCNE2)
   05222 Small cell lung cancer
    112315543 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112315543 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112315543 (CCNE2)
   05161 Hepatitis B
    112315543 (CCNE2)
   05162 Measles
    112315543 (CCNE2)
   05169 Epstein-Barr virus infection
    112315543 (CCNE2)
   05165 Human papillomavirus infection
    112315543 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dro03032]
    112315543 (CCNE2)
   03036 Chromosome and associated proteins [BR:dro03036]
    112315543 (CCNE2)
DNA replication proteins [BR:dro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112315543 (CCNE2)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112315543 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112315543
NCBI-ProteinID: XP_024428048
LinkDB
Position
Unknown
AA seq 409 aa
MSRRSSRLQAKQQPQPSQTDSPQEAQIIQAKKRKTAQDVKKRKEEEVAKKQQYEIRNCWP
PVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFIDPSPLPDLSWGCSKDVWLNMLK
KESRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFHYRILAAA
ALCHFTSIDVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKMFKKISMEDRHNIQT
HTSYLAMLDEVNYINTIRKVGQLSPMCNGGIMTPPKSTEKPPGKQKAAN
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttgcaagctaagcagcagccccagcccagccagactgat
tccccccaagaggcccagataattcaggccaagaagagaaaaacagcccaggatgtcaaa
aaaagaaaagaggaggaggtcgccaagaaacaacagtatgagattaggaattgttggcca
cctgtattatctgggggaatcagtccttgcattatcattgaaacaccccacaaagaaata
ggaacaagtgacttctccagatttacaaattacagatttaaaaatctttttattgatcct
tcacctttgcctgatttaagctggggatgttcaaaggatgtttggctaaacatgttaaag
aaagagagccggtatgttcatgacaaacattttcaagttctgcattctgacctggagcca
cagatgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcat
agagaaacattttatcttgcacaagacttttttgataggtttatgttgacacaaaaggat
ataaataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaactt
gaggaaatctatgctcctaagctccaagagtttgcttatgtcactgatggtgcttgcagt
gaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgt
cctgtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagatgcg
ccgaaagttcttctacctcagtattctcaggaaaagttcattcagatagctcagctttta
gatctgtgtattctcgccattgattcattagagttccactacagaatactggctgctgct
gccttatgccattttacctctattgatgtcgttaagaaagcctcaggtttggaatgggac
agcatttctgaatgtgtagactggatggtgccttttgtcaatgtagttaaaagtactagt
ccagtgaagctgaagatgtttaagaagatttctatggaagacagacacaatatccagaca
catacaagttatctggctatgctggatgaagtaaattacataaacaccatcaggaaggtg
ggacagttgtcacccatgtgcaatggaggtattatgacaccaccgaagagcactgaaaaa
ccaccgggaaaacagaaagcagctaactaa

DBGET integrated database retrieval system