KEGG   Desmodus rotundus (common vampire bat): 112296834Help
Entry
112296834         CDS       T05907                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112296834 (CACNA1E)
   04020 Calcium signaling pathway
    112296834 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112296834 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dro04040]
    112296834 (CACNA1E)
Ion channels [BR:dro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112296834 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 112296834
NCBI-ProteinID: XP_024407365
LinkDB All DBs
Position
Unknown
AA seq 2320 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFTNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEALVLTRTIWLCV
FFTIKRSRTEAMTRDSSDERCVDIASVGTPLARASIKSTKVDGASYFRHKERLLRISIRH
MVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMG
PRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRN
LVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVF
QILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQE
LTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRR
RHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRAR
PIEGLALGLGLEKCEEERVSRGGSLKGDRGDLSSALDNQRSPLSLGKREPPWLSRPCHGN
CDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSSASQSRSASQERSLDDG
MPAEGDKDHEPRGGHGGKEPTIQEEERGLDLRRTNSLMVARGTGLAGALDGADTPLVLPH
AELDLGKGPPEREPEGSSEQALLGDVQLDVGRVISQSEPDLSCVTANTDKAATESTSVTV
AIPDVDPLVDSTVVHISNKTDGEASPLKEAEIKEDEEEEVGKKKQKKEKREGKAMVPHSS
MFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNRVLRYFDYV
FTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIK
TIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFK
GKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGE
GWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDK
MMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNT
VVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIG
SITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCL
LIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSC
LGEKGCEPDTTAPAGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRD
SSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVL
MNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLD
LLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEII
ANAKALPYLQQEPVAGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEFSE
LKSVQPSNHGIYLPPDTQEHAGSGRASSLPRLTVDPQVVTDTSSMRRSFSTIRDKRSNSS
WLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHL
LSPDVSRCNSEERGTQADWESPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSMSDTSTP
RRSRRQLPPVPPKPRPLLSYSSLIRHTGSTSPPADGSEGGSPLTSQALESDEAGLPEASR
SRHTPHGHPSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRANTIGSAPPLR
HSWQMPNGHYRRRRRGGPGPGTICGAVGDLLSDTEEDDKC
NT seq 6963 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtctggcgatggagactcggac
cagagcagaaaccggcaaggaacccccgtgccggcctcgggtccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccctttgagtacatgatcctggccaccatcatc
gccaactgcatcgtgctggctctggagcagcatcttcccgaggacgacaagaccccgatg
tcccgcaggctggagaagacggagccctacttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccacaagggctcatacctccgcaatggctgg
aatgtcatggacttcatcgtggttctcagcgggatcctggccactgcaggaacccacttc
aacacacacgtggacttgaggaccctgcgggccgtgcgtgtcctgaggcccctgaagctc
gtgtccgggatacccagcctgcagatcgtgctgaagtccatcatgaaggccatggtgccc
ctcctgcagattggcctcctgctcttcttcgccatcctgatgttcgccatcatcggcttg
gagttctacagcgggaagctgcaccgcgcgtgcttcacgaacaattcaggtattctggaa
ggatttgacccccctcacccatgtggcgtgcagggctgtcctgctggttacgaatgcagg
gactggatcggccccaacgacgggatcacccagttcgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctatacttcatccccctcatcatcattggatccttc
ttcgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagaaaga
gtggagaaccggagagctttcatgaaactgcggcgccagcagcagattgagcgggagctg
aacgggtaccgtgcctggatagacaaagcagaggaagtcatgcttgccgaagaaaataaa
aatgctggaacgtcagccttggaagccctcgttttgaccagaacgatctggctgtgcgtt
tttttcaccatcaaacgcagccggacggaggccatgactcgagactccagcgatgagcgc
tgtgtcgatatcgcctctgtgggcacccctcttgcccgagccagcatcaaaagcacaaag
gtggatggcgcctcctatttccggcacaaagaaaggcttctgcgcatctccatccgccac
atggttaaatcccaggtgttttactggattgtgctgagccttgtggctctcaacaccgcc
tgtgtggccattgtccatcacaaccagccccagtggctcacgcacctcctctactatgca
gaatttttgtttctgggactcttcctcttggagatgtccctgaagatgtacggcatgggc
cctcgcctttattttcactcttccttcaactgctttgattttggggtcacagtgggcagc
atcttcgaagtggtctgggcaatcttcagacctggcacgtcttttgggatcagtgtctta
cgagctcttcggctgctaagaatatttaaaataacaaagtactgggcatccctgcggaat
ttggtggtctccttgatgagttccatgaagtctatcatcagtttgctcttcctcctcttc
ctcttcatcgttgtctttgctctcctaggaatgcagctgtttggaggcaggttcaacttc
aatgacgggaccccttcagcgaactttgacactttccctgcggccatcatgactgtgttc
cagatcctgacgggtgaggactggaatgaggtgatgtacaacgggatccgctcccagggc
ggcgtcagctcgggcatgtggtcagccatctatttcattgtgctcaccttgtttggaaac
tacacgctgctgaacgtgttcttggccattgctgtggacaatctggccaacgcccaggag
ctgaccaaggatgagcaggaggaagaggaggccttcaaccagaagcatgcactgcagaag
gccaaggaggtcagcccgatgtccgcgcccaacatgccctctatcgaaagagacagaagg
agaagacaccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgc
cgccaccacatgtcggtgtgggagcagcgcactagccagctgaggaggcacatgcagatg
tccagccaggaggccctcaacaaggaagaggccccgcccatgaacccactcaaccctctg
aacccactgagccccctcaacccactcaacgcccaccccagcctctaccggagagcccgg
cccatcgagggcctggccctgggcctgggcctggagaagtgcgaggaggagcgcgtcagc
cgtggggggtccctcaagggcgacagaggggacctctccagtgccctggacaaccaaagg
agccccttgtccctgggcaaacgggagccgccgtggctgtccaggccctgtcatgggaac
tgtgacccaacccagcaagaggctgggggaggggagactgtggtgacctttgaggaccgg
gccaggcacaggcagagccagcggcgcagccggcaccgccgagtcagaacggaaggcaag
gagccctcctccgcctcccagagccggtctgccagccaggagcggagtctggatgacggc
atgcccgccgagggggacaaggaccacgagcccaggggcggccatgggggcaaggagccc
acgatccaggaagaagagaggggcctggacctgaggaggaccaacagcctgatggtggcc
agaggcactgggctggcaggggccctcgatggggctgacactcccctcgtcctgccccac
gcagagctggacttggggaaggggcctccggagcgggagcctgagggcagcagtgagcag
gccctgctgggggacgtgcagctggacgtgggccgggtcatcagccagagcgagcccgac
ctctcctgcgtcacagccaacacagacaaggctgccaccgagagcaccagcgtcacggtg
gccatccccgacgtggaccccttggtggactcgaccgtggtgcacattagcaacaagact
gacggcgaggccagtcccttgaaggaggcagagatcaaggaggatgaggaggaggaggtg
gggaagaagaagcagaagaaggagaagcgggagggcaaggccatggtgccccacagctcc
atgtttatcttcagcaccaccaacccgatccgcagggcctgccactacatcgtgaacctg
cgctacttcgagatgtgcatcctcctggtgatcgcagccagcagcatcgccctggcagcc
gaggaccccgtcctgaccaactcggaacgcaacagagtcttgaggtatttcgactacgtt
ttcactggcgtgttcacctttgagatggttattaagatgatagaccagggcttgattctg
caggacgggtcctacttccgagacctgtggaacatcctagacttcgtggtggtggtcggt
gcactggtggcctttgctctggcgaacgctttgggaaccaacaaggggagggacatcaag
accatcaagtccctgcgggtgctccgagttctgaggccgctgaagaccatcaagcgcttg
cccaagctcaaggctgtcttcgactgcgtggtgacctcactgaaaaacgtcttcaacatt
ctcattgtctacaagctcttcatgttcatcttcgctgtgatcgccgttcagcttttcaag
gggaagttcttttactgcaccgacagctccaaggacacggagaaggagtgcataggcaac
tatgtggatcacgagaaaaacaagatggaggtgaaaggtcgggagtggaagcgccatgaa
ttccactacgacaacatcatctgggccctgctgaccctcttcaccgtctccaccggggaa
ggatggccgcaagtcctgcagcattccgtcgacgtgacagaggaggaccgaggcccgagc
cgcagcaaccgcatggagatgtccatcttctacgtggtctactttgtggtcttccctttc
ttctttgtcaacatcttcgtggctctcatcatcatcaccttccaggagcaaggcgacaag
atgatggaggagtgcagcctggagaagaacgagagggcgtgcatcgacttcgccatcagc
gccaagcctctcacccgctacatgccgcagaacaggcacaccttccagtaccgcgtgtgg
cacttcgtggtgtccccgtccttcgagtacaccatcatggccatgattgccttgaacacc
gtagtgctgatgatgaagtactactctgctccctgcacttacgaactggccctgaagtac
ctgaacatcgccttcaccatggtcttctccttggagtgtgtcctgaagatcatcgccttc
ggcttcttgaactatttccgagacacttggaatatcttcgacttcatcaccgtgatcggc
agcatcacggaaatcattctgacggacagcaagctggtgaacaccagtggcttcaatatg
agctttctgaagctcttccgcgccgcccgcctcatcaagctcctgcgtcagggctacacc
atccgtattttactgtggaccttcgtgcagtcctttaaggccctcccctacgtctgcctt
ttgattgccatgcttttcttcatctatgccatcatcgggatgcaggtatttggaaacata
aaattagacgaggagagtcacatcaaccggcacaacaacttccggagtttctttgggtcc
ctcatgctactcttcaggagcgccaccggggaggcctggcaggagatcatgctgtcgtgc
ctcggggagaagggctgtgagcccgacaccacggcgccggcggggcagagtgagagtgag
cgctgcggcaccgatctggcctacgtgtactttgtctccttcatcttcttctgctccttc
ttgatgctcaacctgttcgtggctgtcatcatggacaactttgagtacctgactcgggac
tcgtccatcctggggcctcaccacttggacgagtttgtccgtgtctgggcagaatatgac
cgagctgcgtgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtca
ccaccgctaggcctcggcaagagatgtccctccaaagtggcatataagaggttggtcctg
atgaatatgcccgtagctgaggacatgacagtccacttcacctccaccctgatggctctg
atacgcacagctctggacatcaaaatcgccaaaggcggtgctgacaggcagcagctagac
tcggagctgcagaaggagaccctggccatctggcctcacctgtcccagaagatgctagat
ctgcttgtgcctatgcctaaagcctctgacctgaccgtgggcaaaatctatgcggcaatg
atgatcatggactactataagcagagtaaggtgaagaaacagaggcagcagctggaggaa
cagaaaaacgcccccatgttccagcgcatggagccctcgtctctgccgcaggagatcatc
gccaatgccaaagctctgccttacctgcagcaggagcccgttgcaggcctgagtggccgg
agtgggtacccttcgatgagtccgctctccccgcaggaaatattccagctggcgtgcatg
gaccccgccgacgacgggcagtttcaggagcagcagtctctggagccagagtttagtgaa
ttaaaaagcgtgcagccctctaaccatggcatctaccttcctccggacacccaggagcat
gcgggatctgggagggcatcctctttgccacgcctgactgtggatccccaggtggtaaca
gacaccagctccatgagacgttccttttccaccatccgggacaagcgctcaaactcctct
tggttggaggaattctccatggagcgaagcagtgaaaacacctacaagtcccgtcgcagg
agttaccactcctccctgcgtctgtcggcccatcgcctgaactcggactctggccacaag
tccgacacacaccgctcaggcggcagagagcgaggccgatcaaaagagcgaaagcatctt
ctctcccccgatgtctcccgctgcaactcagaggagcgcgggacccaggctgactgggag
tccccagagcgacatcagtcccggtctcccagtgagggcaggtcgcagacccccaacaga
cagggcacggggtccttgagtgaaagctccatcccctccatgtctgacaccagcacccca
agacgaagtcgtcggcagctcccccctgtccctccaaagcctcggcccctcctttcctac
agctctctgattcgacacacggggagcacctctccccccgctgatggcagcgaaggtggc
tccccgctgacctcccaagctctggagagcgatgaagctggcctgcctgaggcttccagg
tcccggcacaccccgcacggccacccctccccgcagcgctacatctccgagccctacctg
gccctgcacgaagactcccatgcctcggactgcggtgaggaggagacgctcacgtttgaa
gcggctgtggccaccagcctgggccgtgccaacaccatcggttcagccccacccctgcga
cacagctggcagatgcccaacgggcactatcggcggcggaggcgtggagggccggggccg
ggcacaatatgtggagctgtgggcgacctcctaagtgacacggaagaggatgacaagtgc
tag

DBGET integrated database retrieval system