KEGG   Desmodus rotundus (common vampire bat): 112297709
Entry
112297709         CDS       T05907                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112297709 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    112297709 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112297709 (YWHAQ)
   04114 Oocyte meiosis
    112297709 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112297709 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112297709 (YWHAQ)
   05160 Hepatitis C
    112297709 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112297709 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112297709 (YWHAQ)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112297709 (YWHAQ)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112297709 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 112297709
NCBI-ProteinID: XP_024408222
LinkDB
Position
Unknown
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaaaacggagctgatccagaaagcgaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtcgggggccgccggtccgcctggagg
gtcatctcgagcatcgagcagaaaaccgacacctcggacaagaagttgcagctgattaag
gactaccgggagaaagtggagtcggagctgcggtccatctgcaccacggtcctggaattg
ttggataagtacttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattacttccggtaccttgctgaggttgcatgtggtgatgatcgcaaacaa
acgatagataattcccaaggagcttaccaagaggcttttgatatcagcaagaaggagatg
cagcccactcacccaattcgtctggggctggctctgaacttctctgtgttctactatgag
atcctgaataacccagagctggcctgcacactggctaaaacggctttcgacgaggccatc
gcagagctcgacacactgaacgaggactcctacaaagacagcaccctcatcatgcagctg
cttcgggacaacctcacactatggacatcagacagtgccggagaagaatgcgatgcggca
gaaggggcagaaaactaa

KEGG   Desmodus rotundus (common vampire bat): 112303830
Entry
112303830         CDS       T05907                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112303830 (YWHAB)
   04151 PI3K-Akt signaling pathway
    112303830 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112303830 (YWHAB)
   04114 Oocyte meiosis
    112303830 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112303830 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112303830 (YWHAB)
   05160 Hepatitis C
    112303830 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112303830 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112303830 (YWHAB)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112303830 (YWHAB)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112303830 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 112303830
NCBI-ProteinID: XP_024415148
LinkDB
Position
Unknown
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaagctcgccgagcaggctgagcgc
tacgatgacatggccgcagccatgaaggcagtcacggaacaggggcacgaactctccaat
gaagagaggaacctgctctccgtcgcctacaagaacgtggtaggcgcccgccgttcttct
tggcgtgtcatctccagcattgaacagaagacagagaggaacgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagagctgcaggacatctgcaacgatgttctg
gagctgttggacaaataccttattcccaacgccacacagccagaaagtaaggtgttctac
ttgaagatgaaaggggattattttcggtatctttctgaggtggcatctggagacaataag
caaaccactgtgtcaaactctcagcaggcttaccaggaagcatttgaaattagtaagaag
gaaatgcagcccacacacccaattcgacttggcctggcgctgaatttctcagtcttctac
tatgagattctgaactctcctgaaaaggcttgcagcctggcaaaaacggcgtttgatgaa
gcaattgccgaattggatacactgaatgaggagtcgtacaaagacagcacgctgatcatg
cagttgcttagggacaatctcactctgtggacgtcggaaaaccagggagatgaaggagat
gctggggagggagagaactaa

KEGG   Desmodus rotundus (common vampire bat): 112308406
Entry
112308406         CDS       T05907                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04722  Neurotrophin signaling pathway
dro05160  Hepatitis C
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112308406 (YWHAE)
   04151 PI3K-Akt signaling pathway
    112308406 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112308406 (YWHAE)
   04114 Oocyte meiosis
    112308406 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112308406 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112308406 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112308406 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112308406 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112308406 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112308406 (YWHAE)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112308406 (YWHAE)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112308406 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 112308406
NCBI-ProteinID: XP_024420368
LinkDB
Position
Unknown
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcaggtatggatgtggaattgacagttgaa
gaaaggaacctcctatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaaaggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgaactaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaggctgcagagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatcctattcgcttaggtcttgctctcaatttttccgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Desmodus rotundus (common vampire bat): 112310514
Entry
112310514         CDS       T05907                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro05160  Hepatitis C
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112310514 (YWHAH)
   04151 PI3K-Akt signaling pathway
    112310514 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112310514 (YWHAH)
   04114 Oocyte meiosis
    112310514 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112310514 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112310514 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112310514 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112310514 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112310514 (YWHAH)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112310514 (YWHAH)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112310514 (YWHAH)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112310514 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 112310514
NCBI-ProteinID: XP_024422491
LinkDB
Position
Unknown
AA seq 250 aa
MSSCVQSKTQVEGRIPFQIFQTWSSVFIFGILQVTELNEPLSNEDRNLLSVAYKNVVGAR
RSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQ
YESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLA
LNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSD
QQDEEAGEGN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtccagttgtgtccagagcaagacacaggttgaagggaggattcctttccagattttc
cagacttggagctcagtgtttatctttggcattttgcaggtgacagagctcaatgaacct
ctctccaacgaagatcgaaacctcctctcggtggcctacaagaatgtggttggtgccagg
cgatcttcctggagggtcatcagcagcattgagcagaagaccatggctgatggaaatgaa
aagaagttggagaaggttaaagcttaccgggagaagattgagaaggagctggaaaccgtg
tgcaatgatgtcctcgctctgcttgacaagtttctcatcaagaactgcaatgatttccag
tacgagagcaaggtattttacctgaaaatgaaaggcgattactatcgttacttggcagag
gtagcttccggggagaagaaaaacagtgtggtcgaagcttccgaggcagcctacaaggaa
gcctttgaaatcagcaaagagcacatgcagccgacgcaccccatccggctgggcctggcc
ctcaacttctccgtgttctactacgagatccagaatgcaccggagcaggcctgcctctta
gccaaacaagccttcgatgatgccatcgctgagctggacacactaaacgaagattcctat
aaagactccacgctcatcatgcagttgctgcgagacaacctcaccctctggaccagcgac
cagcaggatgaagaagcaggcgaaggcaactga

KEGG   Desmodus rotundus (common vampire bat): 112314844
Entry
112314844         CDS       T05907                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro05160  Hepatitis C
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112314844 (YWHAG)
   04151 PI3K-Akt signaling pathway
    112314844 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112314844 (YWHAG)
   04114 Oocyte meiosis
    112314844 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112314844 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112314844 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112314844 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112314844 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112314844 (YWHAG)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112314844 (YWHAG)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112314844 (YWHAG)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112314844 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 112314844
NCBI-ProteinID: XP_024427170
LinkDB
Position
Unknown
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtaacagagctgaatgagccactgtccaatgaa
gaaagaaaccttctgtctgtggcctacaagaatgtagttggggcgcgccgttcttcctgg
agggtcattagtagcattgagcagaagacttctgcagatggtaacgagaagaagatagag
atggtccgtgcttaccgtgaaaaaatagagaaggagttggaagcggtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtacgagagcaaa
gtgttttacctgaagatgaaaggggactattaccgctacctggctgaagtggccactgga
gagaaaagggcgactgtcgtggaatcatctgagaaggcctatagcgaagcccatgagatc
agcaaggagcacatgcagcctactcaccccattagattgggcctggctcttaactactcc
gttttctactacgagatccagaatgccccagagcaagcatgccacttggccaagaccgcc
ttcgacgatgccattgccgagctcgacactctcaatgaggactcctacaaggactccact
ctcatcatgcagctcctccgtgacaacctcacgctctggacaagcgatcagcaagacgac
gatggtggagaaggcaacaattaa

KEGG   Desmodus rotundus (common vampire bat): 112315411
Entry
112315411         CDS       T05907                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04151  PI3K-Akt signaling pathway
dro04390  Hippo signaling pathway
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112315411 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    112315411 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112315411 (YWHAZ)
   04114 Oocyte meiosis
    112315411 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112315411 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112315411 (YWHAZ)
   05160 Hepatitis C
    112315411 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112315411 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112315411 (YWHAZ)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112315411 (YWHAZ)
Exosome [BR:dro04147]
 Exosomal proteins
  Proteins found in most exosomes
   112315411 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM
Other DBs
NCBI-GeneID: 112315411
NCBI-ProteinID: XP_024427870
LinkDB
Position
Unknown
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAWEYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcggttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gttgtctcaagtattgagcaaaagacagaaggtgctgagaaaaaacagcagatggcttgg
gaatacagagagaagattgagaccgagctaagagatatctgcaatgatgtcctgtctctc
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacttggccgaggttgctgctggggatgacaagaaaggg
attgtggatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatccgatcagattgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccggagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatactttaagtgaagagtcatacaaagacagcacgctaataatgcagtta
ctgagagacaacttgacattgtggacatcagatacccaaggagacgaagctgaagcagga
gaaggaggagaaaattaa

DBGET integrated database retrieval system