Desmodus rotundus (common vampire bat): 112297747 Help Entry 112297747         CDS       T05907                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04015   Rap1 signaling pathway dro04810   Regulation of actin cytoskeleton dro05014   Amyotrophic lateral sclerosis dro05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112297747 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112297747 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112297747 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112297747 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dro04131]     112297747 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dro04812]     112297747 (PFN4)    04147 Exosome [BR:dro04147]     112297747 (PFN4) Membrane trafficking [BR:dro04131]  Others   Actin-binding proteins    Others     112297747 (PFN4) Cytoskeleton proteins [BR:dro04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112297747 (PFN4) Exosome [BR:dro04147]  Exosomal proteins   Proteins found in most exosomes    112297747 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112297747 NCBI-ProteinID:  XP_024408282 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDALLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQAR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNLYLLVATYTEGMYPSVCVEAAEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatctgcagaacttgctgttagatgccctcctgggcacgaagcacgtggacagc gcagccctcatcaaactccaggagcggagcctgtctgtagcgtcaccagggttcagtgta atgcccagtgatgtccgaacacttgtgaatggcttcgccaagaaccctttgcaagccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgattattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagaccaatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagcgtctgtgtggaggccgcagagaagctg ggagaatatttaagaaaaaaaggaaattaa

DBGET integrated database retrieval system