KEGG   Desmodus rotundus (common vampire bat): 112297879Help
Entry
112297879         CDS       T05907                                 

Gene name
COLGALT2
Definition
(RefSeq) procollagen galactosyltransferase 2
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00310  Lysine degradation
dro00514  Other types of O-glycan biosynthesis
dro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    112297879 (COLGALT2)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    112297879 (COLGALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dro01003]
    112297879 (COLGALT2)
Enzymes [BR:dro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     112297879 (COLGALT2)
Glycosyltransferases [BR:dro01003]
 O-Glycan biosynthesis
  O-linked Gal type
   112297879 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Glyco_transf_92
Motif
Other DBs
NCBI-GeneID: 112297879
NCBI-ProteinID: XP_024408497
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MAIWAATDHNADNTTEILREWLKNVQRAYHYVEWRPMEEPESYPDEIGPKHWPASRFAHV
MKLRQAALRTARDKWSDYILFIDVDNFLTNPQTLNLMIAENKTIVAPMLESRGLYSNFWC
GITPQGFYKRTPDYIQIREWKRTGCFPVPMVHSTFLIDLRKEASDKLMFHPPHQDYAWTF
DDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQDDIESLIHVQIEAMIDRPPME
PSQFVSVVPKYPDKMGFDEIFMINLKRRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTS
QLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSVWKEVIDRELEKTLVIEDDVRFEHQ
FKKKLMKLMDDVDQAQLDWELIYIGRKRMQVTEPEKAVPNVVNLVEADYSYWTLGYAISL
EGAQKLVRADPFGKMLPVDEFLPIMYNKHPVAEYKEHYKSRDLKAFSAEPLLIYPTHYTG
QPGYLSDTETSTIWDNETVATDWDRTHSWKSRKQGHIHHNAKNTEALPPPASLNTVPSRD
EL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccatctgggcagccaccgaccacaacgcggataacacaaccgaaatactcagggag
tggctgaaaaatgtgcagagagcctatcactatgtggagtggaggcctatggaagaaccc
gagtcttatcctgatgaaattggcccaaagcactggcccgcctcccggtttgcccacgtg
atgaaattgcggcaggcagcccttcgaactgcgagggacaaatggtcagactacattctg
ttcattgacgttgacaacttcctgactaatccacagaccctcaatctaatgattgcagaa
aacaaaaccattgtggcccccatgctggagtctcggggcctgtactcgaatttctggtgt
ggaatcacacctcagggcttctataaacggaccccggactacattcagattagggaatgg
aagaggacaggctgcttccccgtccccatggtgcactccaccttcctcattgacctcagg
aaagaagcttccgacaagctgatgttccatcccccgcaccaggactacgcctggaccttc
gatgacatcatcgtcttcgccttctccagcaggcaagcaggcatccagatgtacctctgc
aaccgagagcactacggctacctgcccatccccctgaagccccaccagaccctgcaggat
gacatcgagagcctcatccacgtgcagatagaagcaatgattgatcgtcctccgatggaa
ccctcccagtttgtctcagtggtcccgaagtatccagacaagatgggattcgatgagatt
ttcatgataaacctcaaacgcagaaaggacaggagggaccggatgttgcgcaccctgtac
gagcaggagattgaggtcaagattgtggaagctgtggatggaaaggcgctcaacacaagc
cagctgaaggccctgaacatcgagatgctgcccggatatcgagacccctactcctcccgg
cctctaaccaggggcgaaatcggctgctttctaagccactactccgtctggaaagaggta
attgaccgagagctggagaagacacttgttatcgaggacgatgtgcgctttgaacaccag
tttaagaagaagctcatgaagctgatggatgacgtagaccaggctcagctggactgggaa
ctgatttacattggtaggaagaggatgcaagtaacagagccggagaaagcagtgcccaat
gtggtcaatctggtcgaagccgactattcctactggacgctgggctacgccatctctttg
gaaggagcgcagaagctggtcagagctgatcctttcgggaagatgctgccagtggacgag
ttcctgccaatcatgtacaacaagcaccccgtagcggagtacaaggagcactacaaatcc
agggacttgaaagccttctccgcggagcccttgctcatctaccccacacactacacaggc
cagccgggctacctgagcgacacggagacctcgaccatctgggacaatgagacagtggcc
actgactgggacaggacgcattcctggaagtcccggaagcaaggccatatccaccacaac
gcgaagaacacagaggccctgcccccaccggcctcgctgaacaccgtgccttcgagggac
gagctctga

DBGET integrated database retrieval system