KEGG   Desmodus rotundus (common vampire bat): 112298356
Entry
112298356         CDS       T05907                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04024  cAMP signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04310  Wnt signaling pathway
dro04330  Notch signaling pathway
dro04350  TGF-beta signaling pathway
dro04520  Adherens junction
dro04630  JAK-STAT signaling pathway
dro04720  Long-term potentiation
dro04916  Melanogenesis
dro04919  Thyroid hormone signaling pathway
dro04922  Glucagon signaling pathway
dro04935  Growth hormone synthesis, secretion and action
dro05016  Huntington disease
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05211  Renal cell carcinoma
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112298356 (CREBBP)
   04330 Notch signaling pathway
    112298356 (CREBBP)
   04350 TGF-beta signaling pathway
    112298356 (CREBBP)
   04630 JAK-STAT signaling pathway
    112298356 (CREBBP)
   04066 HIF-1 signaling pathway
    112298356 (CREBBP)
   04068 FoxO signaling pathway
    112298356 (CREBBP)
   04024 cAMP signaling pathway
    112298356 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112298356 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112298356 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112298356 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    112298356 (CREBBP)
   04919 Thyroid hormone signaling pathway
    112298356 (CREBBP)
   04916 Melanogenesis
    112298356 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    112298356 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112298356 (CREBBP)
   05206 MicroRNAs in cancer
    112298356 (CREBBP)
   05203 Viral carcinogenesis
    112298356 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112298356 (CREBBP)
   05215 Prostate cancer
    112298356 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112298356 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112298356 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112298356 (CREBBP)
   05161 Hepatitis B
    112298356 (CREBBP)
   05164 Influenza A
    112298356 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112298356 (CREBBP)
   05165 Human papillomavirus infection
    112298356 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112298356 (CREBBP)
   03036 Chromosome and associated proteins [BR:dro03036]
    112298356 (CREBBP)
   03029 Mitochondrial biogenesis [BR:dro03029]
    112298356 (CREBBP)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     112298356 (CREBBP)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    112298356 (CREBBP)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    112298356 (CREBBP)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    112298356 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 112298356
NCBI-ProteinID: XP_024409068
LinkDB
Position
Unknown
AA seq 2435 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGPLFDLENDLPDELIPNGELGLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGSQAQGQPNNANMASLGAMGKS
PLNQGDSSAPSLPKQAASTSGPTPPASQPLNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPSLLNSNSGHGLLNQPQQGQAQVMNGSLGAAGRGRGAGIPYPTPALQGATSSVLAE
TLTQVSPQIPSHTGLNTAQAGGITKMGMTGNTSPFGQPFSQTGGQPMGAPGVNPQLPSKQ
NVVTSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSM
QRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNALGNNPMNIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQSQPVRPPNGPGPMPLPVNRMQVSQ
GMNSFNPMSLGNVQLPQAPMGPRTASPMNHSVPMNSMGSVPGMAISPSRMPQPSNMMGAH
ANNMLAQAPAQNQFLPQNQFPSSSGAMSVNNVGMGQPAAQTGVSQGQVPGAALPNPLNML
GSQLPCPPVTQSPLHQTPPPATTATGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQTP
TPTPGSVPSASQAQSTPTVQAAAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQAPGTPL
SQAAASIENRVPTPSSVASAETNSQQPGPELPMLEMKAEVKTEDTEPDASEPKGEPGSAM
LEEDLQGSSQVKEESDTTEQKSEPMEVDEKKTEVKVEAKEEEESTANGAASQSASPSQPR
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRK
LDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCG
RKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTT
ISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKE
NKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVD
SGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFR
PRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQE
WYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEE
ERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKL
YATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSL
RRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHK
MVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRV
VQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQ
AQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPTQPQPSPVSMSPAGF
SSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNGM
PPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPIPQQQPMPGMPRPVMS
MQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFI
KQRTAKYVASQPGLQPQPGLQAQPGLQPQPSLHQQPSLQNLNTMQAGGPRPGVPPQQQAM
GGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQGSAGMAAGMA
GHGQFQQPQGPGGYPPAMQQQRMQQHLPMQGSSMGQMAAQMGQLGQMGQPGLGTDSSPNI
QQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPA
PVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSA
MLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7308 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctccgcgaatgacagcacagattttggaccattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggagaattaggcctcttaaacagtgggaaccttgttcca
gatgctgcttccaaacataaacaactgtcggagcttctgcgaggaggcagtggctctagt
atcaacccaggaataggaaatgtgagcgccagcagccctgtgcagcaaggcctcggcagc
caggctcaagggcagccgaacaatgcgaacatggccagtctgggtgccatgggcaagagc
cctctgaaccaaggagattcttcagcgcccagcctaccaaagcaggcagccagcacctct
gggcccactccccctgcttcccaaccactgaatccgcaagcacaaaagcaagtggggctg
gtaaccagcagccctgccacgtcacagacaggacctgggatctgcatgaatgctaacttc
aaccagacccaccccagcctcctcaatagtaactctggccatggtttattgaatcagccc
cagcaggggcaggcgcaagtcatgaatggatctctgggggctgctggcagaggaagggga
gctggaataccataccccactccagctttgcagggggctacaagcagtgtgctggctgag
acgttaacgcaggtttcaccgcaaattcccagtcacacgggactgaacacagcgcaggca
ggaggcataaccaagatgggaatgaccggtaacacaagtccatttggacaaccctttagt
caaactggaggacagccaatgggagcccctggagtgaacccccagttacccagcaaacag
aatgtggtcactagtttgcctcccttccctgcagacatcaagaatgcttcagtcaccaat
gtgccaaacatgtctcagatgcaaacatcagtgggaattgtacctacacaagcaattgca
acgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcatgctcataaatgtcagagacgagaacaagcaaacggagaggttcgggcctgctct
ctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacccattgtcaggctgga
aaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctggggtctccagctagtggaattcagaacacaattggttctgttggt
acaggccagcagaatgctacttctttaagtaacccaaatcccatagaccccagctccatg
cagcgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctgcag
cctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggactctc
aacgccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcagcag
ccaccaaacttgatttcagaatcagctcttccaacttctctcggggccacaaacccactg
atgaatgatggctcaaactctggaaacattggaaccctcagcaccataccaacagcagct
cctccttccagcactggtgttcggaaaggctggcatgaacatgtcactcaggacctacgg
agccatctagtgcataaacttgtccaagccatcttcccaacacctgaccctgcagccctg
aaggatcgccgcatggagaacctagtggcgtatgctaagaaagtagaaggggacatgtat
gagtctgccaatagccgggatgaatactatcacttattagcagagaaaatctacaagata
cagaaagaactagaagaaaaacggaggtcacgtttacacaaacaaggcatcttgggtaac
cagccagccttaccagcccctggggcacagccccctgggattccacagtcacaacctgtg
agacctccaaatgggcccgggcccatgcccctaccagtgaatcgcatgcaggtttctcaa
gggatgaattcatttaacccgatgtccttggggaatgtacagttgccacaagctcccatg
ggaccgcgcacagcatcccccatgaaccactctgtcccaatgaacagcatgggctccgtt
ccagggatggccatttctccttcccgaatgcctcagccttcgaacatgatgggtgcacat
gccaacaacatgctggcccaggcaccagcgcagaaccagttcctgccgcagaaccagttc
ccttcatccagtggggcaatgagtgtgaacaatgtaggcatgggacaaccagcagcccag
acaggcgtgtcacagggacaggtgcctggtgctgcccttcctaaccctctgaacatgctt
gggtcccaacttccttgcccaccagtgacacagtcaccgttacaccagacgccacctcct
gctaccacagccactggcatgccatctctccagcatccaacagctcctgggatgactcct
cctcagccagcagctcccacccagccgtcaactcctgtgtcgtcttccgggcagactccc
accccgactcctggctcagtgcccagtgccagccaagcccagagcacccctacagtccag
gcagcagcccaggtgaccccgcagcctcagaccccagttcagcccccatccgtggccacc
cctcagtcatcacagcagcagccaacgcctgtgcatgcccaggctcctggcacgccgctt
tcccaggcagcagccagcattgagaacagagtacccactccgtcctcagtggccagtgcc
gaaaccaactcccagcagccgggacccgaattaccaatgttggaaatgaaggctgaggtc
aagaccgaggacacggagcctgatgccagtgaacccaagggggagcctgggtctgcgatg
ctggaggaggatctacaaggatcttcccaagttaaagaagaatcagacacaacagagcag
aaatcagaaccaatggaagtagatgaaaagaaaacagaagtcaaagtagaagctaaagag
gaagaagagagcactgctaatggtgccgcctctcagtcagcatctccttcccagccacgc
aaaaaaatctttaagccggaagaattacgccaggctcttatgccaaccctagaagcacta
tatcgacaggatccagagtccttaccttttcgccagcctgttgatccccagctcctagga
attccagattactttgacattgtgaagaaccccatggacctttccaccatcaagcggaag
ttggacacaggacagtaccaagaaccctggcagtatgtggatgatgtctggctgatgttc
aacaatgcctggctctataatcgcaagacgtctcgggtctataagttctgcagtaaactg
gcagaggtctttgagcaagagattgaccctgttatgcaatcccttggatactgctgtgga
cgcaagtatgagttttccccacagactctgtgctgctacgggaagcagctgtgtacaatt
cctcgagatgcagcctactacagctatcagaataggtatcatttctgtgagaagtgtttc
acagagatccagggggagaatgttaccctgggtgacgacccttcacaaccccagacgaca
atttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaacctttcgtt
gattgcaaggaatgtggccggaagatgcatcagatttgtgttttacactatgatatcatt
tggccatcaggctttgtgtgtgacaactgcttgaagaaaactggcagaactcgaaaagaa
aacaaattcagtgctaagcgactgcagaccacacgattgggaaaccatttggaagaccga
gtcaacaagtttttacggcgacagaatcatccagaagctggggaggtctttgtccgagtg
gtggccagctcagacaagactgtggaggtcaagcctgggatgaagtcacggtttgtggac
tctggggaaatgtctgaatctttcccgtatcgaaccaaagctctctttgcctttgaggaa
attgacggagtagatgtgtgcttcttcgggatgcatgtccaagagtatggctctgattgt
ccccctccaaacacaaggcgtgtatacatctcttatttggacagtattcacttcttccgg
ccccgatgccttcgtacagccgtttaccatgagatccttattggatatttagaatatgtg
aagaaattggggtatgtgacaggacacatctgggcctgtccccctagtgaaggagatgac
tacatcttccattgccacccccctgatcaaaaaatcccaaaaccgaagcgcctgcaggag
tggtacaagaagatgctggacaaggcttttgcagagcgaatcatccatgactacaaggac
attttcaaacaagcaactgaagacaggctcaccagtgccaaggaactgccctattttgag
ggtgacttctggcccaatgtgttggaggagagcattaaggagctggaacaagaagaagaa
gagaggaagaaggaagagagcactgcagccagtgagacgacggagggcagccaaggtgac
agcaagaatgccaagaaaaagaataataagaaaaccaacaagaataaaagcagcatcagc
cgggccaacaaaaagaagcccagtatgcccaacgtgtccaatgacttgtcccagaagctc
tatgccaccatggagaagcacaaagaggtcttctttgtgatccacctccatgccgggcct
gtcatcaacacactgccccctattgttgaccctgaccccctgctcagctgcgacctcatg
gacggacgtgatgccttcctcaccctcgccagggacaagcactgggagttctcctccctg
aggcggtccaagtggtccacgctgtgcatgctggtggaattgcatacccagggccaagac
cgttttgtctatacctgcaacgagtgcaagcaccatgtggagacacgctggcactgcact
gtgtgcgaggactatgacctttgtatcaactgctacaacacaaagagccacacccacaag
atggtgaagtggggactgggcctagacgacgagggtggcagccagggtgagccgcagtcc
aagagcccgcaggagtcacggcgcctgagcatccagcgctgtatccagtccctggtgcac
gcctgccagtgccgcaacgccaactgctcgctgccatcctgccagaagatgaagcgggtt
gtgcagcacaccaagggctgtaagcgcaagaccaatggaggctgcccagtgtgcaagcag
ctcattgccctttgctgctaccatgccaaacactgccaagaaaacaaatgccccgtgccc
ttctgcctcaacatcaaacacaagctccgtcagcagcagatccagcaccgcctgcagcaa
gcacagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcagagt
ctgccttcccctacctcagcgccacctgggacccccactcagcagcccagcacaccccag
acaccacagccccccacccagcctcagccctcgcctgtgagcatgtcaccagccggcttc
tccagtgtagctcgaactcagcctcctaccacagtgtccactgggaagcccaccaaccaa
gtgccggctccgccgccccccgcccagccccctcctgcagcggtagaggcggcccggcag
attgaacgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaacaacggcatg
cccccagggcgcacaggcatggtgaccccagtgagccagatggcccctgtgggcctgaac
gtgccccgacccaaccaggtcagtgggcctgtcatgccaaatctgcctcctgggcagtgg
cagcaggcacccatcccccagcagcagccgatgccgggcatgcccaggcctgtgatgtcc
atgcaggcccaaccagctgtggctggacctcggatgcccagtgtgcagccaccccggagc
atctcgcctggcgccctgcaggacctgctgaggaccctgaagtctcccagctccccgcag
cagcaacagcaggtgctcaacatcctcaagtcaaaccctcagctgatggcagctttcatc
aaacagcgcacagccaagtatgtggccagtcagcccggcctgcagccccagcctggcctc
caggcccagcctggcctgcagcctcagcccagtctacaccagcagcccagcctgcagaat
ctgaacaccatgcaagccggtgggccacggcccggtgtgcctccacagcaacaagcaatg
ggaggcctgaatccccagggccaggcactgaacatcatgaacccggggcacaaccccagc
atggcgagcatgaacccgcagtacagagagatgctgcggaggcagctattgcagcagcag
caacagcagcagcagcagcagcaacagcagggtagcgctggcatggccgcaggcatggca
ggacacggccagttccagcagcctcaaggacctggaggttaccccccagccatgcagcag
cagcggatgcagcagcacctacccatgcagggcagctccatgggtcagatggcagctcag
atgggacagcttggccagatggggcagcctgggctgggcacagacagctcccccaacatc
cagcaggccctgcagcagcgaattctgcagcagcagcagatgaagcagcagattgggtcc
ccaggccagccaaaccctatgagcccccagcagcacatgctctcaggacagccacaggcc
tcgcacctccctggccagcagatggccacgtcccttagtagccaggtgcggtctccggcc
cctgtccagtctccacggccccagtcccagcctccacattccagcccatcaccacggata
cagccccagccttcaccacatcacgtctcgccccagactggttccccccacccaggactt
gcagtcaccatggccagctccatagatcagggacatttggggaaccccgaacagagtgca
atgctaccacagctgaatacccccaacaggagtgcattgtccagtgagctgtccctggtc
ggtgacaccaccggagacaccctagaaaagtttgtggagggtttgtag

KEGG   Desmodus rotundus (common vampire bat): 112321623
Entry
112321623         CDS       T05907                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04024  cAMP signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04310  Wnt signaling pathway
dro04330  Notch signaling pathway
dro04350  TGF-beta signaling pathway
dro04520  Adherens junction
dro04630  JAK-STAT signaling pathway
dro04720  Long-term potentiation
dro04916  Melanogenesis
dro04919  Thyroid hormone signaling pathway
dro04922  Glucagon signaling pathway
dro04935  Growth hormone synthesis, secretion and action
dro05016  Huntington disease
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05211  Renal cell carcinoma
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112321623 (EP300)
   04330 Notch signaling pathway
    112321623 (EP300)
   04350 TGF-beta signaling pathway
    112321623 (EP300)
   04630 JAK-STAT signaling pathway
    112321623 (EP300)
   04066 HIF-1 signaling pathway
    112321623 (EP300)
   04068 FoxO signaling pathway
    112321623 (EP300)
   04024 cAMP signaling pathway
    112321623 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112321623 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112321623 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    112321623 (EP300)
   04935 Growth hormone synthesis, secretion and action
    112321623 (EP300)
   04919 Thyroid hormone signaling pathway
    112321623 (EP300)
   04916 Melanogenesis
    112321623 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    112321623 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321623 (EP300)
   05206 MicroRNAs in cancer
    112321623 (EP300)
   05203 Viral carcinogenesis
    112321623 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112321623 (EP300)
   05215 Prostate cancer
    112321623 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112321623 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112321623 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112321623 (EP300)
   05161 Hepatitis B
    112321623 (EP300)
   05164 Influenza A
    112321623 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112321623 (EP300)
   05165 Human papillomavirus infection
    112321623 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112321623 (EP300)
   03036 Chromosome and associated proteins [BR:dro03036]
    112321623 (EP300)
   03029 Mitochondrial biogenesis [BR:dro03029]
    112321623 (EP300)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     112321623 (EP300)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    112321623 (EP300)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    112321623 (EP300)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    112321623 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 112321623
NCBI-ProteinID: XP_024434821
LinkDB
Position
Unknown
AA seq 2412 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPIPNMGLGTSGPNQGPTPSATGMMNSPVNQPAMGMNTGMNAGMNPGMLTAGNGQGM
MPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGPQPLKMGM
MNNPNPYGSPYTQNSGQQIGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGMPSMGQQQ
APQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNL
PHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQ
QSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQV
QAKNQQNQQSGQSPQGMRSMSNINASPMGVNGGVGVQTSNLLSDSMLHSAINSQNPMMNE
NASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRME
NLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQTMSNAAGMVPV
PMNPGPNMGQPQPGMTSNGPLLDPSMVRGSVPNQMMPRITPQPGLNQFGQMNMPQPPIGP
RQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTPFSTQGLNVTNMPLAPTGG
QAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTPTPHHTPP
SIGAQQPPATAIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPPTQLPPQVQPSLAAAASA
DQPQQQPLSQQSTSASAPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAI
SEKQPSQEVKVETKMEVDQPEPADSQPEDIPETKPEDCKVEPAETEERGTELKTEAKEEE
DQPSTSVTQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIP
DYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSE
VFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNE
IQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEMIWP
SGFICDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVH
ASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPP
PNQRRVYISYLDSVHFFRPKCLRTAVYYEILIGYLEYVKKLGYTTGHIWACPPSEGDDYI
FHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDIFKQATEDRLTSAKELPYFEGD
FWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGN
KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGR
DAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCE
DYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQ
CRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL
NIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTSQQPTTPQ
TPQKTQPPSQPQPTPPNSMPPYLPRTQASGPVSQGKAPGQVTPPTPPQTAQPPLPGPPPA
AVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPNGHLEPGM
GPTGMQQQPPWAQGALPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPG
TVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPLPGQP
GMPQGQPGLQPPAMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQ
AQQMNMNHNTMPSQFRDILRRQQMMQQQQQGAGPGIGPGMANHNQFQQPQGVGYSPQQQQ
QQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQ
HMLPNQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSP
QTSSPHPGLVAAQANPMEQGHFASPDQNPMLSQLTSNPGMANLHGASATDLGLSTDNSDL
NSNLSQSTLDIH
NT seq 7239 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgacggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctaaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaggtttgataaacagc
atggtcaaaagcccaatccccaacatggggctgggcactagtggaccaaatcagggtccc
acgccatctgcaacaggtatgatgaacagtccggtgaatcaacctgccatgggaatgaac
acagggatgaatgctggcatgaatcctggaatgttgaccgcaggcaatggacaggggatg
atgcctaatcaggtcatgaacggttcgattggagcaggccgagggcgacctaatatgcag
tacccaaacccaggcatgggaaatgctggcaacttaatgactgagccactgcagcagggc
tctccccaaatgggaggacagacaggattgagaggcccccagcctcttaagatgggaatg
atgaacaaccctaatccttatggttcgccatacactcagaattctggacaacagattgga
gccagtggccttggtctccagattccgacgaagtctgttctaccaaatagcttgtctccg
tttgcaatggacaaaaaggcagttcctggtggaggaatgcccagcatgggccaacagcag
gcccctcaggtccagcagccaggccttgtgactccagtagcccaagggatgggttctgga
gcccacacggctgatccagagaagcgcaaactcatccaacagcagcttgtcctcctcttg
catgcgcacaagtgccagcgccgggagcaggctaacggggaggtgcggcagtgcaacctt
ccccactgtcgcacaatgaagaacgtcctaaaccatatgacacactgccagtcaggcaag
tcctgccaagtggcacactgtgcatcttctcgacaaatcatttcacactggaagaactgt
acaaggcatgattgtcctgtgtgtctcccccttaaaaatgctggggataagagaaatcaa
cagtcaattctgactggagcaccagttggacttggaaataccagctctctaggggttggt
cagcagtctacacccagcttaagcactgttagtcagattgaccccagctctatagaaaga
gcctacgcagccctcggactgccctatcaagtaaatcagatgccgacacagccccaggta
caggcaaagaaccagcagaatcagcagtctgggcagtctccccaaggcatgcggtccatg
agcaacattaatgctagtcctatgggagtaaatggaggtgtaggggttcaaacttcgaat
cttctttctgactccatgttgcattcagccataaattctcaaaacccgatgatgaatgaa
aatgccagtgtggcctccctgggtcctatgccaacggcagctcagccatccaatactgga
attcggaaacagtggcatgaagatattactcaggatcttcgaaatcatcttgttcacaaa
cttgttcaagccatatttcctactccggatcctgctgctttaaaagacagacgaatggaa
aacctagttgcatatgcccggaaagtggaaggggacatgtatgaatctgcaaataatcga
gcggaatactaccacctgctagctgagaagatctataaaatccagaaagaactagaagaa
aaacgaaggactagactacagaaacaaacaatgtcaaatgctgcaggcatggtgccggtt
cccatgaatccagggcctaacatggggcagccacaaccaggaatgacttctaatggccct
ctgcttgatccatctatggtccgtggcagtgtgccaaaccaaatgatgcctcggataact
ccacaacctggtttaaatcagtttggccagatgaatatgccccagccccctattggaccc
cggcaaacctctcctcttcagcaccatggacagttagctcagcctggaacactcaaccca
cctatgggctatgggcctcgaatgcagcagccttccagtcagagccagttccttccccag
actccgttctcaacacagggattgaatgtaacgaatatgcctttggctccgactggcggt
caagcaccagtgtctcaagcacaaatgtccagttcttcctgcccggtgaactcacctata
atgcctccagggtctcaagggagccacattcactgtccccctctccctcaaccagctctg
catcagaattcaccctctcccgtacctagtcgtacccctacccctcaccacacaccccca
agcataggggctcagcagccaccagcaacagcaattccagcccctgttcctacacctcca
gccatgccacctggaccacagtcccaggctctacatccacctccaaggcagacacctaca
ccaccaccaacgcaacttcctccccaagtgcagccttcacttgctgctgctgcttcagct
gaccagccacagcagcagcctctctcacagcagagtacatcagcatctgctcccacgccg
acagcaccgctgctgcctccgcagcctgccactccactttcccagccagctgtaagcatt
gaggggcaggtatcaaaccctccatctactagtagcacagaagtgaattctcaggccatt
tctgagaagcagccttcacaggaagtgaaagtggagactaaaatggaagtggatcagcca
gaaccagcagattctcagccagaggatattccagagactaaaccggaagactgtaaggtg
gaacctgcagaaacagaagagagaggcactgaattaaaaaccgaagcaaaagaggaggaa
gaccagccaagtacttcagttacccagtcgtctccagccccaggacagtcaaagaaaaag
attttcaaaccagaagaattacgtcaggcactgatgccaacattggaggcactttaccga
caggatccagaatcccttccctttcgtcagcctgtggaccctcagcttctaggaatccct
gattactttgatattgtaaagagccccatggatctttctaccatcaagaggaagttagac
actggacagtatcaggagccctggcagtatgtggatgacatttggcttatgttcaacaat
gcctggttatataatcggaaaacatcgcgggtgtacaaatactgctccaagctgtctgag
gtctttgaacaagaaattgacccagtcatgcaaagccttggatattgttgtggcagaaag
ttggaattttctccacagacactctgttgctatggcaagcagctgtgcacaatccctcgt
gatgccacatactacagttaccagaacaggtatcatttctgtgagaagtgtttcaatgaa
atccaaggggagagcgtttctttgggggatgacccttcccagcctcaaactacaataaat
aaagaacagttttccaagagaaaaaatgacacactggatcctgaactgtttgtggaatgt
acagagtgtggaagaaagatgcatcagatctgtgttcttcaccatgagatgatctggcca
tcggggtttatttgtgatggctgtttaaagaaaactgcacgaactaggaaagaaaataag
ttttctgctaaaaggttgccatctaccaggcttggcacttttctagagaatcgtgtgaat
gactttctgaggcgacaaaatcaccctgagtcaggagaagtcactgttcgtgtagtacat
gcttctgacaaaactgtggaggtcaaaccaggcatgaaagcaaggtttgtggatagcgga
gagatggcggaatcctttccctatcgaaccaaagccctctttgcctttgaggagattgac
ggtgtggacttgtgcttctttggcatgcatgttcaggagtatggctcggactgccccccg
cccaaccagaggagagtgtacatatcatacctcgatagtgttcatttcttccgtccaaaa
tgcttgaggactgcagtctactatgaaatcctaattggatatttagaatatgtcaagaaa
ctaggttataccacagggcatatttgggcatgtccccccagtgaaggagatgactatatc
ttccattgccatcctcctgaccagaagatacccaagcccaagcgactgcaagagtggtac
aaaaagatgcttgacaagtccgtgtctgagagaattgtccatgactacaaggatattttt
aaacaagctactgaagatcgattaacaagtgcaaaggaattgccctactttgaaggtgat
ttctggcccaatgttctggaagagagcattaaggaactggaacaggaggaggaagagcgg
aagcgagaggaaaataccagcaatgaaagcacagatgtgacaaagggagacagcaaaaat
gctaagaagaagaacaataagaaaaccagcaaaaacaagagcagcctgagtaggggcaac
aagaagaagccaggcatgcccaacgtgtccaatgacctctcgcagaaactgtacgccacc
atggagaaacataaagaggtcttctttgtcattcgcctcattgccggccctgccgccaac
tccctgcctcccatcgtggatcctgaccccctcatcccctgcgatctgatggatgggcgg
gatgcctttctcacccttgcaagagacaagcacctggagttctcatccctccgaagagcc
cagtggtccaccatgtgcatgctggtggagctgcacacccagagccaggaccgctttgtc
tacacctgcaatgagtgcaagcaccacgtggagacacgctggcactgcaccgtctgcgag
gattacgatttgtgtatcacctgctataacactaaaaaccatgaccacaaaatggagaaa
ctagggcttggcttagatgatgagagcaacaaccagcaggctgcagccacccagagccca
ggagactctcgccgcctgagcatccagcgctgcatccagtctctggtccatgcctgccag
tgccgaaatgccaattgctccctgccctcctgccagaagatgaaacgggttgtgcagcac
accaagggttgcaaacggaaaaccaatggagggtgccccatctgcaagcaactcatcgcc
ctctgctgctaccatgccaagcactgccaggagaacaagtgccctgtgccgttctgccta
aacatcaagcaaaagctccggcagcagcagctgcaacaccggctccagcaggcccagatg
ctccgcaggaggatggccagcatgcagcggactggtgtggtggggcagcagcagggcctg
ccttccccaactcctgccactccaaccacgccgaccagccaacagcccaccaccccacag
accccccaaaaaacccagcccccctctcagcctcagcccacccctcccaacagcatgcca
ccctacttgcccaggactcaagcttctggccctgtgtcccagggtaaagcaccaggccag
gtgacccctccaacccctcctcagactgctcagccaccgcttccggggcccccacccgca
gcagtggaaatggcgatgcagattcaaagggcagctgagacacagcgccagatggcccac
gtgcagatatttcaaaggccaatccagcaccagatgccccagatgaccccaatggccccc
atgggtatgaacccacctcccatggccagaggtcccaatgggcatttggagccagggatg
ggccccactgggatgcagcaacagccaccgtgggcccaaggagcattgcctcagccccag
cagctacagtctgggatgccaaggccagccatgatgtcggtggcccaacatggtcagccc
ttgaacatggctccccaaccaggattgggccaggtcggtgtgagccctctcaaaccaggc
actgtgtctcaacaagccttacaaaaccttttgcggactctcaggtctcccagctctccc
ctacagcagcaacaggtgcttagtatccttcatgccaatccccagctgttggctgcattc
attaagcagcgggctgccaagtacgccaactcaaatccgcaacccctccctgggcagcct
ggcatgccccagggccagccagggctgcagcctcctgccatgccaggtcagcagggggtc
cactccaatccagccatgcagaacatgaatcccatgcaggcaggtgtccagagggctggc
ctgccccagcaacaaccacagcagcagctccagccgcccatgggagggatgagccctcag
gctcagcagatgaacatgaatcacaacaccatgccttcacagttccgagacatcttgaga
cgacaacagatgatgcagcagcagcaacagggagcagggccaggaattggccctgggatg
gccaaccacaaccagttccagcaaccccaaggagttggctactccccacagcagcagcag
caacagcaacggatgcagcatcatatgcaacagatgcaacaagggaacatgggacagatg
ggccagctcccccaggccttgggagccgaggcaggagccagtctgcaggcctatcagcag
cgactccttcagcaacagatggggtcccctgctcagcccaaccccatgagcccacaacaa
catatgctcccaaatcaggctcagtccccacacctacaaggccagcagatcccttcttct
ctctccaatcaagtgcgctctccccagcctgtcccttctccacggccgcagtctcagccc
ccccactccagcccttccccaaggatgcagcctcagccttctccacaccacgtctcccca
cagaccagttctccacatccgggactggtagcagcccaagccaaccccatggaacaaggg
cattttgccagcccggaccagaatccaatgctttctcaactcactagcaatccaggcatg
gcaaacctccatggtgcaagcgccacagacctgggactcagcaccgataactcggacttg
aattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system