KEGG   Desmodus rotundus (common vampire bat): 112298562
Entry
112298562         CDS       T05907                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04062  Chemokine signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04217  Necroptosis
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04630  JAK-STAT signaling pathway
dro04659  Th17 cell differentiation
dro04917  Prolactin signaling pathway
dro04920  Adipocytokine signaling pathway
dro04931  Insulin resistance
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro05145  Toxoplasmosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05212  Pancreatic cancer
dro05221  Acute myeloid leukemia
dro05223  Non-small cell lung cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112298562 (STAT3)
   04066 HIF-1 signaling pathway
    112298562 (STAT3)
   04068 FoxO signaling pathway
    112298562 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112298562 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112298562 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112298562 (STAT3)
   04062 Chemokine signaling pathway
    112298562 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112298562 (STAT3)
   04917 Prolactin signaling pathway
    112298562 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    112298562 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112298562 (STAT3)
   05206 MicroRNAs in cancer
    112298562 (STAT3)
   05205 Proteoglycans in cancer
    112298562 (STAT3)
   05203 Viral carcinogenesis
    112298562 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112298562 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112298562 (STAT3)
   05221 Acute myeloid leukemia
    112298562 (STAT3)
   05223 Non-small cell lung cancer
    112298562 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112298562 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112298562 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112298562 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    112298562 (STAT3)
   05161 Hepatitis B
    112298562 (STAT3)
   05160 Hepatitis C
    112298562 (STAT3)
   05163 Human cytomegalovirus infection
    112298562 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112298562 (STAT3)
   05169 Epstein-Barr virus infection
    112298562 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112298562 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112298562 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112298562 (STAT3)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    112298562 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N
Other DBs
NCBI-GeneID: 112298562
NCBI-ProteinID: XP_024409275
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHSTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADTGSAAPYLKTKFICVTPTTCSS
TIDLPMSPRTLDSLMQFGNNGEGAEPSSGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacactcggtacctggagcagcttcatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggattgagagt
caagattgggcgtacgcggccagcaaagaatcgcacgccactctggtgtttcacaatctc
ctgggtgagattgaccagcagtacagccgcttcctacaggaatcaaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatctggagaagccgatggag
atcgcccgaattgtggcccggtgcctgtgggaagagtcccgcctcctgcagactgcagcc
actgcagcccagcaagggggccaggccaaccactccacagctgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaggacgtccggaagcgagtgcaggatctagaacag
aaaatgaaagtggtagagaacctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctagaacagatgctgactgcgctggaccagatgcggcgaagcattgtgagtgag
ttggcggggcttttgtcagccatggagtacgtgcagaaaactctcacggatgaggagctg
gctgactggaagaggcggcaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagagaactggataacctcattagcagaatcccaacttcagacccgccaacaa
attaagaagctggaggagctgcagcagaaagtgtcctacaaaggggaccctatcgtacag
caccggccaatgctggaggagagaatcgtggagctcttcagaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcaccccgaccggccgctagtcatcaag
accggtgtccagtttacaactaaagtcagattgctggtcaaattccctgagttaaattat
cagcttaaaattaaagtttgcatcgacaaagactcgggggatgtagcggctctcagagga
tcccggaagtttaacattctgggcacaaacacgaaagtcatgaacatggaagagtccaac
aacggcagcctctctgcagaattcaaacacttgaccctgagagagcaaagatgtggtaac
gggggccgagccaactgtgacgcctccctgatcgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtaccaccaaggcctcaagattgacctagagacccactccttgccc
gtggtggtgatttccaacatctgccagatgccgaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaatgtgaactttttcacgaaaccccccatcggaacc
tgggatcaggtggccgaggtgctgagctggcagttctcttccaccacgaagcgagggttg
agcatcgagcagttgaccacgctggcagagaaactcctaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaaaggcttttcc
ttctgggtctggctggacaatatcatcgatcttgtgaaaaagtacattctggccctttgg
aatgaagggtacataatgggcttcatcagcaaggaacgggagagggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacttgggtagagaaggacatcagcggtaagacccagatccagtcggtggagccatac
accaagcagcagctgaacaacatgtcgttcgcggaaatcatcatgggctacaagatcatg
gatgccaccaacatcctggtgtctcccctggtctacctctaccccgacattcccaaggag
gaggcgttcggaaagtactgtcggccagagagccaggagcatcctgaggctgacacaggt
agtgccgccccctacctgaagaccaagtttatctgcgtgacaccaacgacctgcagcagt
accattgacctgccgatgtccccccgcactttagattccttgatgcagtttggaaataat
ggtgaaggtgctgagccctcatcgggagggcagttcgagtccctcacattcgacatggaa
ctgacctcagagtgcgccacctcccccatgtga

DBGET integrated database retrieval system