KEGG   Desmodus rotundus (common vampire bat): 112298647Help
Entry
112298647         CDS       T05907                                 

Gene name
CASKIN2
Definition
(RefSeq) caskin-2 isoform X1
  KO
K21952  CASK-interacting protein
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112298647 (CASKIN2)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112298647 (CASKIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 SAM_1 Ank_4 Ank Ank_3 Caskin-Pro-rich SAM_2 Caskin-tail SH3_2 Caskin1-CID SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 112298647
NCBI-ProteinID: XP_024409437
LinkDB All DBs
Position
Unknown
AA seq 1201 aa AA seqDB search
MGREQDLILAVKNGDVTGVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVKLLLRASAAVNVASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGTLTSRLPSVP
TPLRPNFSRTPQPPADDPLHPLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHSTGLLIENAQPLTSAEEDQVLPALHPPSLADNLSHRPLANCRSGEQLFTQDV
RPEQLLEGKDAQAIYNWLSEFQLEGYTTHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSIAEWLPSYIPADLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLQGEAPGEGNRRLARGPELMAIEGLENGDGPAVA
GPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQPS
GGDASTPQERNLPEGTERPPKLCSPLPGQGPPPYVFMYPQGSPSSPAPGPPPGAPRAFSY
LAGPPAAPPDPPRPKRRSHSLSRPGPTEGEIEGEAEGPVGSALSSYATLTRRPGRSALAR
ASPSQTPARGAPRSQSFALRARRKGPPPPPPKRLSSVSGPTPDPPPLDGGPGPKEGATGP
RRRTLSEPAGPSEPPGPPAPAGPASDTEEEEDPGPEGTPPSRGSSGEGLPFAEEGNLTIK
QRPKPAGPAPRETPVPAALEFNLTESDTVKRRPRCREREPLQTALLAFGVASAMPSPSVP
LPSHSQPPSESPVASPSPPQPDPNGLPTQGAPAPLFPSPPTQPPIAPCPGPALENSAVNR
RHEEPEPPAPPAAFIKMPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGS
AGSGQAQQRLEQTSSSLAAALRAAERSIGAEEREGTSTKHILDDISTMFDALADQLDAML
D
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgaacaggacctgattcttgctgtcaaaaacggagatgtgactggtgtgcag
aaactggtagctaaagtcaaggctgcaaagacaaagctcctgggctccacgaagaggctc
aacgtcaactaccaggatgcggatggattctctgctcttcaccatgccgccttggggggc
agcctggagctcatagccttgctgctggaggctcaggccaccgtggacatcaaggacagc
aatggcatgcgcccactgcactacgcagcctggcagggccgtctggagcctgtgaagctg
ctgctgcgggcctccgcggccgtcaacgtcgcctctctggacgggcagatcccactgcac
ctggccgcccagtatggccactatgaagtgtcagaaatgcttctccagcatcagtccaac
ccttgcctggtcaacaaggccaagaagacgcccctggacctggcctgcgagtttgggcgg
ctcaaggtggcccagctactgctgaatagccacttatgtgtggccctgctggagggagag
gccaaggacccgtgtgaccccaactacaccacacccttgcacttggctgccaagaatggc
cacagagaggtcatcaggcagctcctgagagccggaattgagatcaaccgccagaccaag
acgggcacggcgctgcacgaggccgcgctgtacggcaagaccgaggtggtgcggctgctc
ctggagggcggggtggacgtgaacattcggaacacgtacaaccagacggcactggacatt
gtgaatcagttcaccacctcccaggccagccgggaaatcaagcagctgctgcgggaggcc
tcagggatcctgaaggttcgcgcactcaaggatttctggaacctccacgatcccactgcc
ctcaatgtccgggcaggggacgtcattacggtgcttgagcagcatcctgatggccgctgg
aaggggcatatccacgagagccagaggggcacagaccgtgtgggctactttcctcctggc
attgttgaagtggtcagcaagcgggtgggcacccttacatcccgcctcccctctgtgccc
acccccctgcgtccaaacttctcccggactccgcagccccctgctgacgaccccctgcac
cccctcacctatggccagctcccacgagtgggcctgagcccagacagcccagcaggtgac
aggaatagcgtgggcagtgagggcagcgtgggcagcatccgcagtgccggcagcgggcag
agttccgagggcaccaacggccatagcactggactccttattgagaacgcccagccactt
acgtctgccgaagaggaccaggtgctgccagcactgcaccccccatccctggcagacaac
ttgagccaccgccctctggccaactgtcgctctggggagcagctcttcacccaggatgtg
aggccagagcagctgctagaggggaaggatgcgcaggccatctacaactggctgagtgag
ttccagctggagggctataccacccactttctgcaagccggctacgatgtgcccaccatc
agccgcatgacacccgaggacctgacggccatcggggtgacgaagcctgggcacaggaag
aagattgcctcggagatcgcccagctcagcattgccgagtggctgcccagctacatcccg
gcggacctgctggagtggctgtgtgcattggggctgccgcagtaccacaagcagctggtg
agcagcggctatgactccatggggctggtggccgacctcacctgggaggagctgcaggag
attggcgtcaataagcttggacatcagaagaagctcatgctgggtgtgaagcgtctagcc
gaactccggcggggcctgctgcagggggaggccccaggcgagggcaaccgccgactggcc
aggggcccggagctgatggccatcgaagggctggagaatggggacggacctgctgtggct
ggcccacgcctcctcacctttcagggcagcgagctgagcccagagctacaggcagccatg
gcaggggggggccctgagcctctccccctgccccctgcccgctcccccagccaggagagc
attggggcacgctcacgagggtctggtcactcacaggaacagcctgccccccagcccagt
ggcggagatgccagtaccccacaggaaaggaaccttccagaaggcacagagcggcctcct
aagctttgttccccacttcctggccaagggcctcccccttatgtttttatgtacccccag
ggctcaccctccagcccagccccagggccacccccaggtgcaccccgggccttctcatac
ttggctggcccgcctgctgctcctccggacccgcctaggcccaagcgccggtcccacagc
ctgagccgccctggcccgactgagggggaaatagagggcgaggccgaagggccggtgggc
agtgccttgagcagttatgccaccctcactcggcgaccaggacgcagtgccctagcccgg
gccagccccagccagacgccagctcgaggggctccccgcagccagtcctttgctctccgg
gccaggcgcaaaggccctccaccacctcctccaaagcgcctcagctctgtctctggcccc
accccggacccacctccactggatggaggcccaggacccaaagagggggccacagggccc
cgaaggcgaacactgagtgaaccagctgggccatcggagccccctggcccacctgcccca
gctggccctgcatcagacacagaggaagaggaggatccaggacctgaggggacacccccg
tctcggggaagctcaggggaagggctcccgttcgcggaggagggcaacctgactatcaaa
cagcggccgaagcctgctggccccgcaccccgggagacacccgtgcccgctgccctcgag
ttcaacctcacagagtcagacactgtaaagcggaggcccaggtgccgggagagagagcca
ctgcagacagcgctgctggccttcggagtggccagtgccatgcccagcccctctgtcccc
ttgccttcccattcccagccccccagtgagtcccctgtggcttcccccagccctcctcag
cctgaccctaatggccttccaacacaaggagctccggcccctctttttcccagcccccca
acccagcctcccatagccccctgccctgggccagctctggaaaactcagcagtcaatcgg
cggcacgaggagccggagcccccagcgccccctgctgccttcatcaagatgcccggagca
ggaacagctcccaagcctgtgtctgtggcctgcacccagctggcattttctggccctaag
ctggctccccgacttggcccccgccctgtgcctcctccaagaccggagagcacagggtct
gcgggctcgggccaggcccagcagagactggagcagaccagctcgtccctggcagctgcg
ctgcgggcggcggagaggagcattggcgctgaggagcgagagggcacctctaccaagcac
attctggatgacatcagcaccatgtttgacgccctggctgaccagctggatgccatgctg
gactga

DBGET integrated database retrieval system