KEGG   Desmodus rotundus (common vampire bat): 112298771
Entry
112298771         CDS       T05907                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04015  Rap1 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04640  Hematopoietic cell lineage
dro04810  Regulation of actin cytoskeleton
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112298771 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    112298771 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112298771 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112298771 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112298771 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112298771 (ITGA2B)
   04611 Platelet activation
    112298771 (ITGA2B)
   04613  Neutrophil extracellular trap formation
    112298771 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112298771 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112298771 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112298771 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    112298771 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112298771 (ITGA2B)
   05414 Dilated cardiomyopathy
    112298771 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112298771 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112298771 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112298771 (ITGA2B)
   04515 Cell adhesion molecules [BR:dro04515]
    112298771 (ITGA2B)
   04090 CD molecules [BR:dro04090]
    112298771 (ITGA2B)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112298771 (ITGA2B)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112298771 (ITGA2B)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin alpha subunits
   112298771 (ITGA2B)
CD molecules [BR:dro04090]
 Proteins
  112298771 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112298771
NCBI-ProteinID: XP_024409646
LinkDB
Position
Unknown
AA seq 1036 aa
MARALCPLHALWLLEWVQMLLGPGAAPPASALNLDPERLTFYTGPNGSHFGFSLDFCKDS
HSSMAIVVGAPRTLGRNQEEMGGVFMCPWRAEGGQCSSLPFDLNDETRKVGSQTFQTFKA
GQGLGASVVSWNDNIVACAPWQHWNALEETEEAEKTPVGGCFLAQLQNARRAEFSPCRSN
TMSRVYLAYRYWEDRRYCEAGFSSVVTEAGELVLGAPGGYFFLGLLAQAPIADIFSSYRP
GTLLWHVRTQRFTFDSSHPEYFDGYRGYSVAVGEFDGNPNTTEYVLGAPTWSWTLGAVEI
LHSNYGTLHRLQGEQVASYFGHSVAVTDVNGDGRHDLLVGAPLYMDSRSDRKLAEVGRVY
LFLQPRGSQALGTPSLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQVLDSPFPTGSGFGFSLRGATDIDDNGYPDLLVGAYGADKVAVYR
AQPVVMATVQLMVQDSLNPAVKDCVLPQTKTSVSCFGIQMCVGATGHNIPQQLSLNAELQ
LDRQKPRQGRRVLLLNSQQAGATLHLDLGGRHSPICHNIKAFLRDEADFRDKLSPIVLSV
NVSLPPAKDGLAPALVLHGDTLVQEQTRIVLDCGEDDLCVPQLQLAASVTGSPLLIGADN
VLELKMDAANEGEGAYDAELAVHLPPGAHYMRALSDVEGFERLICNQKKENETKVVLCEL
GNPMKNVRIGITMLVSVENLEEAGEHVSFWLQIRSKNSQNPNSEIVQLDVPVRADAHVEL
RGSSFPAFLVMAAEEGNRENSSDSWGPKVEHTYELYNNGPGTVNGLYLTLCLPGQSQPTD
LLYILDVQLQGGLQCTPQPSPNPLKLDLGLPTPSPSPIHPGHHKRERRQASLPGPKQPGW
LRDPVLVSCDSVPFTVVQCELQEMARGQRAMVTVQAFLWLPSLRQRPLDQFVLQSHAWFN
VTSLPYAVPALSLPSGEALVQTQLLRALEERSIPIWWVLVGVLGGLLLLTLLVLAMWKVG
FFKRNRPPLEEDEEEE
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggccagagccttgtgtccacttcatgccctctggcttctggagtgggtgcagatgctc
ttgggacctggtgctgcccctccagcctcggccttgaacttggacccagagcggctcacc
ttctacacaggccccaatggcagccactttgggttttcattggacttctgcaaagacagc
catagcagcatggccatcgtggtgggcgccccgcggaccctgggtcgcaaccaagaggag
atgggcggcgtgttcatgtgcccctggagagctgagggcggccagtgttcctccctgccc
ttcgaccttaatgatgagacccgaaaagtaggctcccaaactttccaaaccttcaaggcc
gggcaaggactgggggcgtcggtcgtcagctggaacgacaacattgtggcctgcgccccc
tggcagcactggaacgccctagaagagaccgaggaggcggagaagacacccgtaggtggc
tgcttcttagctcagctccagaacgcccgccgcgcagagttctcgccttgtcggtccaac
accatgagccgggtttacttggcgtatagatactgggaagaccggcgctactgtgaagcc
ggcttcagctccgtagtcaccgaggctggagagctggtgcttggggcccctggcggctat
tttttcttaggtctcctggcgcaggctccaatagcagacatcttctcgagttaccgcccg
ggcaccctcttgtggcatgtgcgcacccaacgcttcaccttcgactccagccatccagag
tacttcgacggctaccgggggtattcggtggccgttggcgagttcgacgggaatcccaac
actacagagtatgtcctcggtgcccccacctggagctggaccctgggagccgtggaaatt
ttgcactccaactacggaacgctgcaccggctgcaaggagagcaggtggcttcgtatttc
gggcactcggtggccgtcactgacgtcaacggggacgggaggcacgacctgctggtgggg
gcgccgctgtacatggacagccgctctgaccgcaagctggccgaggtggggcgtgtgtac
ttgttcctgcagcctcggggctcccaggcgctgggcacccccagcctcctactgactggc
acacagctctatgggcgatttggctcagccatcgcacccctgggcgatctcaaccgggat
ggctacaatgatgttgcagtggctgccccctatgggggtcccagtggtcggggccaagtg
ctggtgttcctgggccagagtgaggggcttagctcacgcccctcccaggtcctggacagc
cccttccccacaggctctggcttcggcttctccctgcgaggtgccacagacatcgatgac
aatggatacccagacttattggtgggagcatacggggctgacaaggtggctgtgtacaga
gctcagccagtggtgatggccactgtccagctgatggtacaagattcgctgaatcctgct
gtgaaggattgtgtcctgccgcagaccaagacatcagtgagctgctttggaatccagatg
tgtgtaggagccacgggacacaatattcctcagcagctaagcctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctgctgctgaactctcaacaggcg
ggcgccaccctgcacctagacctgggggggaggcacagccccatctgccacaacatcaag
gccttcctccgtgatgaggccgacttccgggacaagctgagccccatcgtgctcagcgtc
aacgtgtccctgccacctgcaaaggatggactagcccctgctcttgtgctgcatggagac
acccttgtccaggagcagacccgcatcgtcctggactgcggggaagacgacctgtgtgtg
ccccagcttcagctcgctgccagcgtgacgggctccccgctcctcattggagccgataat
gtgctggagctaaagatggacgcagccaacgagggggagggggcctatgacgctgaattg
gccgtgcacctgccccccggtgcccactacatgagggctctcagcgatgtcgagggtttt
gagaggcttatctgtaaccagaagaaggagaatgagaccaaggtcgtgctgtgtgagctg
ggcaaccccatgaagaatgtccggataggaatcaccatgttggtcagtgtggagaacctg
gaagaggctggggagcatgtgtccttctggctgcagatcaggagcaagaacagtcagaat
ccgaacagcgagattgtgcagctggatgtgccggtccgggcggacgcccatgtggagctt
cgagggagctcctttccagccttcctggtgatggcagcagaagaaggcaacagagagaac
agctcggacagctggggccccaaagtggagcacacctatgagctctacaacaatggccct
ggtaccgtgaatggcctctacctcaccctctgcctccctggccaatcccagccgaccgac
ctgctctacatcctggatgtacagcttcaggggggtcttcagtgcaccccacagccctct
cccaaccccctcaagctggacttggggctgcccaccccttccccctcccccattcaccca
ggccatcacaagcgggagcgcaggcaggcttccctgccagggcccaagcagccagggtgg
cttcgggatccagttcttgtgagctgcgactcggtgccctttaccgtggtgcaatgtgag
ctgcaggagatggcgcgtgggcagcgggccatggtcactgtgcaggccttcctgtggctg
cccagcctccgccagaggccactggatcagtttgtactgcagtcccacgcctggttcaat
gtcacctcccttccctacgctgtgcctgccctcagcctgcccagtggggaagctctggtg
cagacacagctgcttcgggctttggaggagaggagcattcccatctggtgggtgctggtg
ggcgtgctgggtggcctgctgctgctcacactcctggtcttggccatgtggaaggtcggc
ttcttcaagcggaatcggccacccctggaagaggatgaagaggaggagtga

KEGG   Desmodus rotundus (common vampire bat): 112305765
Entry
112305765         CDS       T05907                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04514  Cell adhesion molecules
dro04810  Regulation of actin cytoskeleton
dro04919  Thyroid hormone signaling pathway
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112305765 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112305765 (ITGAV)
   04514 Cell adhesion molecules
    112305765 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112305765 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112305765 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112305765 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112305765 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112305765 (ITGAV)
   05205 Proteoglycans in cancer
    112305765 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112305765 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112305765 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    112305765 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112305765 (ITGAV)
   05414 Dilated cardiomyopathy
    112305765 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112305765 (ITGAV)
   05165 Human papillomavirus infection
    112305765 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112305765 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112305765 (ITGAV)
   04515 Cell adhesion molecules [BR:dro04515]
    112305765 (ITGAV)
   04090 CD molecules [BR:dro04090]
    112305765 (ITGAV)
Membrane trafficking [BR:dro04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112305765 (ITGAV)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112305765 (ITGAV)
  Exosomal proteins of epithelial cells
   112305765 (ITGAV)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin alpha subunits
   112305765 (ITGAV)
CD molecules [BR:dro04090]
 Proteins
  112305765 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112305765
NCBI-ProteinID: XP_024417266
LinkDB
Position
Unknown
AA seq 1254 aa
MDSEAQRSPPSITEDLENVCPEAPRRAAGNLSLPGQFDSGRGVVPGAWWDERKEPCEQHF
HKQSHSMSPQQKRSLTFISDILQSKKGGQYEARSIPVGLSDNAGSPVAREFLAGAGVEGC
PWCYSGRRRVWTTRSAAHADADSEGLGPRSTDAGCMGQEAIAREEVQSVSPQGRKTLHQH
FLPQGGSASRPGSSSSSASSPRCRCTPAAGGRRWLRLHPRRLLLLLPGFLLPLCGAFNLD
VDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSQ
RRCQPIEFDATGNRDFAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREP
VGTCFLQDGTKTVEYAPCRSKNIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLI
SDQVAEIVSKYDPKVYSITYNNQLATRTAQAVFDDSYLGYSVAVGDFNGDGIDDFVSGVP
RAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDVNGDDYADVFIGAPLFMDRG
SDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPY
GGEDKKGIVYIFNGRSTGLNAVPSQILEGKWAAQSMPPSFGYAMKGATDIDKNGYPDLIV
GAFGVDRAVLYRARPVITVNAGLEVYPSILNQDNKTCPLPGTDLKVSCFNVRFCLKADGK
GALPTKLNFQVELLLDKLKQKGAIRRALFLHNRSPGHSKNMTISRGGQMQCEELIAYLRD
ESEFRDKLTPITIFMEYRLDYRTAADATGLPPVLNQFTPANVSRQAHILLDCGEDNVCKP
KLEVSVDRDQKKIYVGDDNPLTLIVKAQNQGEGAYEAELIVSIPPQADFIGVVRNSEALA
RLSCAFKTENHTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFD
KVSPIVSYRVDLAVLAAVEIRGVSSPDHIFLPVPNWEHKENPETEEDVGPVIQHIYELRN
NGPSSFSKAMLNLQWPYKYNNSTLLYILQYDIDGPMNCTSDVEINPLRIKVSSSQTTEKN
DTLAGQGGRNHLVTKRDLTQSEGGVHTLGCGIAECLKIVCQVGRLDRGKSAILYVKSLLW
TETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDIFNSTLVTTNVTWGIQPAPMPVPV
WVIILAVLAGLLLLAVLVFVMHRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3765 nt   +upstreamnt  +downstreamnt
atggactcagaagcacaaaggtccccaccctccattacagaagacctagaaaacgtctgc
ccagaagcccccagaagagctgcaggaaatttgtccctgccagggcagttcgattctgga
cgaggggtggtccctggtgcctggtgggatgagaggaaagagccttgtgagcagcacttc
cacaaacaaagccacagcatgtctccacagcaaaagcgatctctgactttcatctctgac
attctgcagagtaagaaaggtggacagtatgaagcgagatccatacccgtagggttgtca
gataatgcaggatccccagtcgcacgggagttcctggcaggagcaggggtagaggggtgt
ccttggtgctactcaggacgcaggcgggtttggaccaccaggagcgctgcccacgccgac
gcggactctgagggtctggggcctcggagtacagacgccgggtgcatgggacaggaggcg
atagctcgcgaggaagtgcaatcggtctcgccccaggggaggaagactctccaccagcac
ttcctcccgcaaggcggctcagcctcccggcccggctcctcctcctcctccgcctcctcc
ccccgctgccgctgcactccggcggcgggggggcggcggtggcttcgccttcacccgcgc
cgccttctgctccttcttcccggattcctgctgcctctttgcggcgccttcaacctagac
gtggacagtcctgccgagtactctgggccagaaggaagttactttggtttcgctgtggat
ttcttcgtgcccagcgcgtcttccaggatgtttcttctggtgggcgcacccaaagcaaac
actacccagcctgggattgtggaaggagggcaagtcctcaagtgtgattggtcttcacag
cgcaggtgccagccaattgaatttgatgcaacaggcaatagagattttgccaaggacgat
ccattggaatttaagtcccaccagtggtttggagcatctgtgagatcaaagcaggataaa
attttggcctgtgccccactgtaccactggaggactgaaatgaaacaggagagagagccg
gtgggaacttgctttcttcaggatggaacaaagactgttgagtatgctccgtgcagatcg
aaaaatattgatgctgatggacagggattttgtcaaggaggattcagcattgattttact
aaagctgacagagtacttcttggtggtcctggtagcttttattggcaaggtcagctcata
tcggatcaagtggcagaaattgtatccaaatatgaccccaaagtttacagcatcacctat
aacaaccagttagcaactcggaccgcacaagctgtttttgatgacagttatttgggttac
tccgtggctgtcggcgatttcaatggtgatggcatagacgactttgtttcaggagttcca
agagcagcgaggactttaggaatggtttatatttatgatgggaaaaacatgtcatcctta
cacaattttactggtgagcagatggctgcatattttggattttctgtcgctgccactgac
gttaatggagatgactatgcagatgtgttcattggcgcacctctattcatggatcgtggt
tcagacggcaaactccaagaggtgggacaggtctcagtgtctctgcaaagagcctcgggg
gacttccagacgaccaagctgaatgggtttgaagtctttgcaaggttcggcagtgccata
gcacctttgggagacctggaccaggacggcttcaatgatattgcgattgctgctccctat
gggggtgaagataaaaaaggaattgtgtatattttcaatggaagatcaacgggcttgaat
gccgtgccatctcaaatccttgaagggaagtgggctgcccagagcatgccgccaagcttt
ggctatgcaatgaaaggagccacagatatagacaaaaatggatatccagacttaattgta
ggagcttttggtgtagatagagctgtgttgtacagagccagaccggttatcactgtaaat
gccggccttgaagtgtaccctagcattttaaatcaagacaataaaacctgcccactgcct
gggacagatctgaaagtttcctgttttaacgtcaggttctgcttaaaggcagatggcaaa
ggagcacttcccacaaaactcaatttccaggtggaacttcttttggataaactcaagcaa
aaaggagcaattcgacgagcactgtttctccataacaggtccccgggccactccaagaac
atgaccatttcccgggggggccagatgcagtgtgaggagctgatagcctatctgcgggat
gagtctgaatttagggacaaactcactccaataactatttttatggagtaccggttggat
tacagaacagcggctgacgcaacaggcttgccgcccgtccttaaccagttcactcccgcc
aacgtcagtcgacaggcacatattctccttgattgtggtgaagacaatgtgtgtaaaccc
aaactggaagtttctgtagacagggatcaaaagaagatctatgttggggatgacaaccct
ctgacattgatcgttaaggctcagaaccaaggagaaggggcctacgaagctgagctcatt
gtctccatcccacctcaggctgatttcattggggttgtccgcaatagtgaagccttagca
agactttcctgtgcatttaagacagaaaaccacacccgccaggtggtatgtgaccttgga
aacccaatgaaggctggaactcaactcttagctggtctccgtttcagtgttcaccagcaa
tcagagatggatacttctgtgaaatttgatttacaaatccaaagctccaatctttttgac
aaagtaagcccgattgtatcttacagagttgaccttgctgttttagctgctgttgagata
agaggggtctcaagtcccgatcacatctttcttccggttccaaattgggagcacaaggag
aaccccgagactgaagaagacgttgggccagttattcagcacatctatgagctgagaaac
aacgggccaagttcattcagcaaggcaatgctgaatcttcagtggccttacaaatacaac
aatagcaccctgttgtacatcctccagtacgatatcgacgggccgatgaactgcacttca
gatgtggagatcaaccctttgagaattaaggtttcaagttcacaaacaacggagaagaat
gacacccttgctgggcaaggtggccggaaccatctcgtcactaagcgggatctcacccag
agtgaaggaggtgttcacactttgggttgtggaatcgccgaatgcttgaagattgtctgc
caggttgggcgactggacagaggcaagagcgccatcctttatgtgaagtctctgctgtgg
accgagacctttatgaataaggaaaaccagaatcattcatactctctgaagtcatctgct
tcatttaatgtcattgagtttccttataagaaccttcccatcgaggatatcttcaactcc
acattagttaccaccaacgtcacctggggcattcagccagcacccatgcccgtgcctgtg
tgggtaataattttagcagttctagcagggttgttgttgttggctgttttggtgtttgtg
atgcacaggatgggcttttttaaacgtgttagaccacctcaagaagaacaagaaagggaa
cagcttcaacctcatgaaaatggtgaaggaaactcagaaacttaa

KEGG   Desmodus rotundus (common vampire bat): 112305805
Entry
112305805         CDS       T05907                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04514  Cell adhesion molecules
dro04640  Hematopoietic cell lineage
dro04810  Regulation of actin cytoskeleton
dro05145  Toxoplasmosis
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112305805 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112305805 (ITGA6)
   04514 Cell adhesion molecules
    112305805 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112305805 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112305805 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112305805 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112305805 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112305805 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112305805 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112305805 (ITGA6)
   05414 Dilated cardiomyopathy
    112305805 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112305805 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112305805 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112305805 (ITGA6)
   04515 Cell adhesion molecules [BR:dro04515]
    112305805 (ITGA6)
   04090 CD molecules [BR:dro04090]
    112305805 (ITGA6)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112305805 (ITGA6)
  Exosomal proteins of breast milk
   112305805 (ITGA6)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin alpha subunits
   112305805 (ITGA6)
CD molecules [BR:dro04090]
 Proteins
  112305805 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LRR19-TM
Other DBs
NCBI-GeneID: 112305805
NCBI-ProteinID: XP_024417330
LinkDB
Position
Unknown
AA seq 1043 aa
MYAVQQNLEWGELLLVGAPRAVALPLQRANRTGGLYSCDITSPGPCTRIEFDNNADPSSE
SKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDEMD
GGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFD
MNIFEDGPYEVGGETDHDESLVPVPANSYLGFSLDSGKGIISKDDITFVSGAPRANHSGA
VVLLRREVKSAHLFPEHIFEGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVG
GAVYVYINQQGRWKNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGNGKVF
VYHGSVNGINTKPTQVLEGNSRFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVI
NIQKTVTVTPTRIDLRQKTVCGAPSGICLKVKACFEYTAKPTGYNPSISIVGTLEAEKER
RKSGLSSRVQFRNQGAEPKYTKEITLNRQKQKVCMEETLWLQENIRDKLRPIPITASVEI
QEPSTRRRVNSLPEVLPILNSNEPKTVQTDVHFLKEGCGHDNVCNSNLKLEYKFCTREGN
QDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSDPRNPTKDGDDAHEAKVVATFPDTL
TYSAYRELKAFPEKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTELTFDTTDLD
INLKLETTSNQDNLASITASAKVVIELLLSVSGVAKPSQVYFGGTVLGEQAMKSEDDMGS
LIEYEFRVINLGKPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKIACEPQEEIN
FLNIKESHNSRKKREIAEKQIDEGRKLLLFGERKYQTLNCSVNVKCVNIRCPLRGLDSKA
SVVLRSRLWNSTFLEEYSKMNYLDILVRASIDVTAATENIKLPNAGTQVRVTVFPSKTIA
QHSGVPWWVILVAILAGILMLALLVLLLWKCGFFKRSRYDDSIPRYQAVKIPKEEREIKD
EKYNDNLEKKQWITRWNDNESYS
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgtatgctgtacagcagaacctagagtggggagagctgctgctcgtgggggccccccgg
gcggttgcccttccactgcagagggccaacagaactggaggcctgtacagctgcgacatc
acctctcccggcccttgcactcggattgaatttgataacaacgctgacccttcatcggaa
agcaaggaagatcagtggatgggggtcaccgtccagagccagggtcccgggggcaaagtc
gtgacgtgtgctcatcgatacgaaaagagacaacacgtgaacacaaagcaggaatcccgg
gacatcttcggaaggtgttacgtcctgagtcagaatctgaggattgaagacgagatggat
gggggagactggagtttttgtgacggccgactgagaggccacgagaagtttggctcttgc
cagcaaggcgtagcagccacctttacgaaagactttcattacattgtatttggagccccg
ggcacttataactggaaagggatcgttcgtgtagagcaaaaaaataacactttttttgac
atgaacatctttgaagatgggccttacgaagttggtggagagaccgaccatgacgagagt
ctagttcctgttcccgctaacagttacttaggcttttctttggactcagggaaagggatt
atttctaaagatgacatcacttttgtatctggagctccgagagccaatcacagtggagct
gtggttttgctaagaagagaagtgaagtctgctcatcttttccccgagcacatatttgag
ggggaaggtctggcttcctcatttggctacgatgtggcggtggtggaccttaacaaagat
gggtggcaagacatagttattggagccccacagtactttgacagagatggagaagtcgga
ggtgcagtgtatgtctacattaaccagcaaggcagatggaaaaacgtcaagccaattcgt
cttaatggaaccaaagattctatgtttggcattgctgtcaaaaatattggcgatattaat
caagatggctacccagacattgcagttggagctccctatgatggtaatggaaaagtgttt
gtctatcatggatctgtgaacggaataaacaccaaaccaacccaggttctcgagggtaat
tcacgtttctttggatattcaattgctggaaatatggaccttgatagaaattcctaccct
gacgttgccgttggctccctctcagattcagtgactattttcaggtctcggcctgtgatt
aatattcagaaaaccgtcacagtaacacctaccaggattgacctccgccagaaaacggtc
tgcggggcacccagtgggatctgcctcaaggttaaggcctgctttgaatacactgccaag
cccacaggttacaatccttcaatatccattgtgggcacactggaggctgaaaaggaaaga
agaaaatctgggctgtcatcacgagttcagtttcgaaaccaaggtgctgagcccaagtat
actaaggagataactctgaacaggcagaagcagaaggtgtgcatggaggaaaccctctgg
ctgcaggaaaatatcagagataaactgcgtcccatccccataactgcttcagtagagatc
caagagccaagcactcggaggcgagtgaattcacttccagaggttcttcccattcttaac
tcaaatgaacccaagactgttcaaacagatgtgcacttcttgaaagagggatgtggacac
gacaatgtgtgtaacagcaacctgaaactagagtataagttttgtacccgggaaggaaac
caagacaagttttcctacttaccgattcaaaaaggtgttccagaactagttctaaaagat
cagaaggacattgctttagaaataacagtgaccaacagcccttccgacccaaggaacccc
acaaaagacggtgacgacgctcacgaagctaaagtcgtcgcaacgtttccagacactttg
acttactctgcgtacagagagctgaaggctttccccgagaagcagttgagttgtgttgcc
aaccagaatggctcacaagcagattgtgagctcggaaatccttttaaaagaaattccagt
gttactttttatttgattttgagtacaactgagctcacctttgacaccacagatctggat
attaatctgaagctggaaacaacgagcaatcaggataatttggcttcaattacagcttcg
gcaaaagtggttattgaactgcttttatcggtctctggagttgccaaaccttcccaggtg
tattttggaggtacagttcttggtgagcaagctatgaaatctgaggatgacatgggaagt
ttaatagagtatgagttcagggttattaacctgggcaagcctcttaaaaacctcggcaca
gcaaccttgaatatccagtggcccaaagaaatcagcaacggcaaatggttgctttatttg
gtgaaagtagaatccaaaggattggaaaagatagcttgtgagccacaagaggaaataaac
tttctgaacataaaggaatcgcacaactcgagaaagaaacgggaaattgctgaaaaacag
attgatgaaggcagaaaattgcttttatttggtgaaagaaaataccagacccttaactgc
agcgtcaacgtgaagtgtgtgaacatcaggtgcccgctgcggggcctggacagcaaggcc
tccgttgttctgcgctcgaggttatggaatagcacatttctagaggagtattctaaaatg
aactacttggacattctcgtgcgagcttccattgatgtgactgctgccaccgagaatatc
aagctgccaaacgctggcactcaggtccgtgtgaccgtgtttccctcgaagaccatagct
cagcattcgggagtgccctggtgggtcatcctagtggccattctcgctggaattttgatg
cttgctctgttagttctattattatggaagtgtggattctttaaacgctctaggtacgat
gacagcattccccgttaccaagctgtaaagatcccaaaagaagagcgagagatcaaagat
gaaaaatataatgataacctggaaaaaaaacagtggatcacgaggtggaatgacaatgaa
agctactcgtag

KEGG   Desmodus rotundus (common vampire bat): 112315265
Entry
112315265         CDS       T05907                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04145  Phagosome
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04611  Platelet activation
dro04640  Hematopoietic cell lineage
dro04810  Regulation of actin cytoskeleton
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112315265 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112315265 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112315265 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112315265 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112315265 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112315265 (ITGA2)
   04611 Platelet activation
    112315265 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112315265 (ITGA2)
   05205 Proteoglycans in cancer
    112315265 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112315265 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112315265 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112315265 (ITGA2)
   05414 Dilated cardiomyopathy
    112315265 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112315265 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112315265 (ITGA2)
   04515 Cell adhesion molecules [BR:dro04515]
    112315265 (ITGA2)
   04090 CD molecules [BR:dro04090]
    112315265 (ITGA2)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112315265 (ITGA2)
  Exosomal proteins of bladder cancer cells
   112315265 (ITGA2)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin alpha subunits
   112315265 (ITGA2)
CD molecules [BR:dro04090]
 Proteins
  112315265 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha HisK_sensor Arch_flagellin PQQ_2
Other DBs
NCBI-GeneID: 112315265
NCBI-ProteinID: XP_024427714
LinkDB
Position
Unknown
AA seq 1178 aa
MRLGRTGTAPRRLVLLLIQGILNCCKAYNVGLLEAKIFSGPSSEQFGYTVQQFMNPKGNW
LLIGSPWSGFPENRMGDVYKCPVDRPTSTCEKLNLQTSISIPNVTEMKTNMNLGLTLARN
VGTGGFLTCGPLFAQQCGSQYYATGVCSDVSPDFQRSASFSPAVQTCTSYIDVVVVCDES
NSIYPWEAVKNFLEKFVQGLDIGPTKTQVALIQYANKPRVVFNLNTFKTKAKMIAATSQT
FQNGGDLTNTFKAIKYARDFAYTPEAGGRPGATRVMVVVTDGESHDGSMLKDVIEQCNEY
NILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAATIGEHIF
SIEGTVQGGDKFQMEMSQVGFSADYAPENDVLMLGAVGAYDWSGTVVQQTSHGHLIFPKE
AFEEILQDRNHSSYLGYSVATISTGKGVHFVAGAPRANYTGQIVLYRVNESGNVTVVQAH
RGDQIGSYFGSVLCAVDVDGDGVTDVLLVGAPMYMNDRKKEEGRVYLFTITKGVLNWHRF
LEGPEGVENARFGSAIAALSDINMDGLNDVIVGAPLENHDSGAVYIYNGHEGTIRTKCSQ
KILGSDRAFRSPLQFFGRSLDGYGDLNGDSITDVSVGAFGHVVQLWSQSIADVSIDASFT
PEKITLSNKNAEVRLRLCFGAKFRPAKQDNQVAITCNITIDADLYSSRVTPRGLFRENNE
RALQKNVVVGQAQTCSEFIINIQPSDIVSPLDLCVNISLASPGSSPALEAYSETAKVFSV
PFYKDCGEDGVCISDLVLTVQQVPAAQGQPFIVSSQNRRLTFSVALKNKKESAYNTGLVV
DFSENLFFASMSVPVDGTEVTCQVASSQKSVACDVGYPALKQRQQVTFTINFDFNLQNLQ
NQASVSFRAFSESDEENMADNSVSFQIPLLYDADIHITRSTNINFYEVSPDGSVPSAVHS
FEDIGPSFTFSIKVATGSIPVSMASVTIHIPQHTQAKNPLLYLTGIHTSQAGDISCNAEI
NPLKIGQTSSPVSFKSENFRHVNELNCRTASCQNVTCWLRDPQVKAEYFLNVSTRIWNGT
FAASTFQTVQLTATAEINTYNPQVYVIQDNSVTIPITIMKPHEKAEVPTGVVVGSVIAGI
LLLLALVAILWKLGFFKRKYEKMAKNPDEVDETTELNS
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgcggctgggacgcacggggaccgccccgcggcggctggtgctgctgctcattcaaggc
attttaaattgttgtaaggcatacaatgtcggtctcctggaagcgaagatcttttccggc
ccttcgagtgaacagttcgggtacacagtgcagcagtttatgaatccaaagggcaactgg
ttgctgattggttcaccttggagcggcttccctgagaaccggatgggagacgtgtacaag
tgtcctgtggaccggcccacctcgacctgtgagaagctcaatttgcaaacttccataagc
atccccaacgtcactgagatgaaaaccaacatgaaccttggcttgacgctcgcaaggaac
gtggggaccggaggatttctcacgtgtggcccgctgtttgcacagcagtgcggaagccag
tattacgcaacaggtgtttgctccgacgtcagccccgacttccagcgctcggccagcttc
tccccggctgtgcagacctgcacttcctacatagatgtggtggtggtgtgtgatgagtcg
aacagcatctatccctgggaggcagtgaagaacttcttggaaaaattcgtacaaggcctg
gatataggtcccacaaagacgcaggtggcgctaattcagtatgccaacaagccaagagtg
gtgtttaacctgaacacttttaaaaccaaagccaaaatgatagcggcaacgtcgcagaca
ttccagaacggcggggacctcacaaacacctttaaagcaattaaatacgcaagggacttc
gcttacacgccggaggcaggggggcggccaggcgctaccagggtcatggtggttgtgacc
gacggggagtcgcacgacggctccatgttgaaagacgtcattgagcagtgtaacgagtac
aacatactgaggttcggcatagcagttctaggctacttaaacagaaatgcccttgatacg
aagaacttaataaaagaaattaaagccatcgccagtattccaaccgaaagatactttttc
aatgtgtctgatgaggcagctctcctggaaaaggcggcgacgataggagagcacattttc
agcatcgaaggcactgttcaaggaggagataagttccagatggaaatgtcacaagtggga
ttcagcgcagattacgctccagaaaacgatgtcctgatgctgggtgccgtcggagcctat
gactggagtggaactgtagttcagcagacatctcacggacacctgatcttccctaaggaa
gccttcgaggagattctgcaagataggaaccacagttcctacttaggttactctgtggcc
acaatctctactggaaagggggtccacttcgtcgcgggtgctcctcgggcaaattatacc
ggccagatagtgctataccgtgtcaacgagagtggcaatgtcaccgtggttcaggctcac
agaggcgaccagatcggctcctatttcggcagcgtgctgtgcgcggtcgacgtggatgga
gacggcgtgaccgacgtgctcctggtaggtgcacccatgtacatgaacgaccgaaagaag
gaggaaggacgggtctacctgtttactatcacaaagggtgttttgaattggcaccggttt
ctggaaggccccgagggcgtcgaaaatgctcggttcggctcggccatcgcggctctctcg
gacatcaacatggatggccttaacgacgtgatcgtgggggcacctctggaaaaccacgac
tccggcgccgtgtacatctacaacggccacgagggcaccatccgcaccaagtgctcccag
aaaatcctggggtctgacagagccttccggagccctctgcagttcttcggcaggtcctta
gacggctacggagatctaaatggggactccatcaccgacgtgtccgtgggcgccttcggg
catgtcgtgcagctctggtcgcagagtattgctgacgtgtctatagatgcttccttcaca
ccagaaaaaatcaccttgtccaacaagaatgccgaggtgcgcctgagactctgcttcggg
gcgaagttcagacccgctaagcaggacaaccaagtggccattacgtgtaacatcacaatt
gacgcagacctgtactcatccagagtcacccccaggggcttgttccgggaaaacaatgag
agggccctgcagaagaacgtggtcgtcggtcaagcgcagacttgctccgagttcatcatc
aacatacagccctcggatattgtcagccccttggacctgtgcgtgaacatcagcctggca
tccccgggctccagccccgccctcgaggcctactccgagaccgccaaggtcttcagcgtc
cctttctacaaggactgcggagaagatggagtttgcatctctgacctagtgctcacggtc
caacaggtgccggctgctcaaggacaacccttcattgtcagcagccaaaacagaaggctg
accttttcggtagcgctgaaaaacaagaaggaaagtgcgtacaacactgggcttgtggtg
gatttctcagagaacttgttttttgcttccatgtccgtgccggtggatgggacagaagtc
acgtgccaggttgcttcctctcagaagtctgtagcctgcgacgtaggctaccctgcactg
aagcagagacaacaggtgacgtttaccatcaacttcgacttcaatcttcaaaaccttcag
aatcaggcgtctgtcagtttccgcgccttcagtgaaagcgatgaggaaaacatggcagac
aattcggtcagcttccaaatccctctgctgtacgatgccgacattcacataacgaggtcg
accaacataaatttttatgaagtctcgccagatgggagcgttccttccgcggtgcacagt
tttgaagatatcggcccaagcttcaccttctccatcaaggtggccacgggcagtattccg
gtgagcatggcatccgtcaccatccacatcccccagcacacccaagcaaagaacccgctg
ctgtacctgacgggcatccacacaagtcaggccggtgacatcagctgtaatgccgaaata
aatcccctgaaaataggacagacatcttctcctgtgtctttcaagagtgaaaacttccgg
cacgtgaacgaattgaactgcaggaccgcctcctgtcagaacgtcacctgctggctgagg
gacccgcaggtgaaagccgagtacttcctgaacgtgtccactaggatctggaacgggact
ttcgcggcgtcgaccttccagactgtacagctgacggccactgcggaaatcaacacctac
aacccacaggtgtacgtgatccaggacaactcggtcacgattcccattacgataatgaag
cctcatgagaaagccgaagtgccgaccggagttgtagtaggaagtgtgatcgctggaatc
ctattgctattagctctggttgcgattttatggaagctcggcttcttcaaaagaaaatac
gaaaaaatggccaaaaatccagacgaggttgacgagaccacagaactcaacagctga

KEGG   Desmodus rotundus (common vampire bat): 112316285
Entry
112316285         CDS       T05907                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04512  ECM-receptor interaction
dro04640  Hematopoietic cell lineage
dro04810  Regulation of actin cytoskeleton
dro05165  Human papillomavirus infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112316285 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112316285 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112316285 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112316285 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112316285 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112316285 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112316285 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112316285 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112316285 (ITGA3)
   05414 Dilated cardiomyopathy
    112316285 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112316285 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112316285 (ITGA3)
   04515 Cell adhesion molecules [BR:dro04515]
    112316285 (ITGA3)
   04090 CD molecules [BR:dro04090]
    112316285 (ITGA3)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112316285 (ITGA3)
Cell adhesion molecules [BR:dro04515]
 Integrins
  Integrin alpha subunits
   112316285 (ITGA3)
CD molecules [BR:dro04090]
 Proteins
  112316285 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 112316285
NCBI-ProteinID: XP_024428866
LinkDB
Position
Unknown
AA seq 1066 aa
MGPSPRGTIRVLRPMLCALALMVAPGGHVASAFNLDTRFLVVKEARNPGSLFGYSVALHR
QTEQELRYLLLVGAPRDLAVPDGYTNRTGAVYLCPLTGHKDDCERMDITETSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNNLELDATDDWQTY
HNEMCNSNTDYLETGMCQLGASGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEFSYK
DPEDQGNLYIGYTVQVGSAILHPTDITIVTGAPRHQHIGAVFLLSQEVGGDLRRRQVLEG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKKEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSRSAFGFSVASIGDINQDGFQDIAVGAPFEGLGTVYIYHSSSRGLLRQPQQVIHGE
DLRLPGLASFGYSLSGKMDVDENFYPDLLVGSLSDRIVLLRARPVINILHRTLEARPSVL
DPALCTATSCVQVELCFAYRQSAGNPNYRRNITLAYTLEADRDRRPPRLRFVQSQSAVFH
GFFSMPEMRCQKLELLLMDNIRDKLHPIVISMNYSLPLHFPERPRLGMRSLDAYPVLNQA
QALENHTEVQFQKECGQDNKCDSNLQMQAAFVSEQGQQMSRLQYSKDLRRLLLSINVTNA
PSRERAGEDAHEALLTLAVPPALLLSSVRPAGACQANETILCELGNPFKQNQRMELLIAF
EVIGVTLHTRELQAQLQLSTSSHQDNLWPMTLTLLVDYTLQASLSMVSHRLQSYFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGDGLASLGTLVLGLEWPYEVANGKWLLYPTEITIQG
NGSWPCRPPGDLINPLNLTLSVPGDRRPSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
QLSCGSVHARCVWLECPIPDAPVITNVTVQARVWNSTFIEDYRDFDRVRVASWATLFLRT
SIPTINMENKTVPFSVDIDSELVEELPAEIELWLVLVSVGAGLLLLGIIILLLWKCDFFK
RTRYYQIMPKYHAVRIREEERYPPPGGTLPTKKHWVTSWQTWDQYY
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgggccccagtccccgcggcaccatccgcgtcctgcgcccgatgctctgcgcgctcgcc
ttgatggtggcccctggcggtcacgtcgcctccgccttcaacctggacacccgattcctg
gtggtgaaggaggccaggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacggagcaggagctgcgctacctgctcctggttggtgccccccgggacctcgctgtg
cctgatggctataccaaccggaccggcgctgtgtacctgtgcccgctcactggccacaag
gacgactgtgagaggatggacatcacggagacaagtgaccctgaccatcacataattgag
gacatgtggcttggggtgactgtggccagccagggccctgcaggcagagtcctggtctgc
gcccaccgctacacccaggtgctgtggtcggggtcggaagaccagcggcgcatggtgggc
aagtgctatgtgcggggcaacaacctggagctggacgccaccgacgactggcagacctac
cacaacgagatgtgcaacagcaacaccgactacctggagactggcatgtgccagctgggc
gccagcggcggcttcacccagaacaccgtgtacttcggtgctcccggggcctacaactgg
aaagggaacagctacatgattcagcggaaggactgggatttatctgaattcagttacaag
gacccggaggaccagggaaacctctatattgggtacacggtgcaggtgggaagcgccatc
ctgcaccctacagacatcaccattgtgacgggtgccccgcggcaccaacatataggtgca
gtcttcttgctgagccaggaggtaggcggagacctgcggaggaggcaggtgctggagggc
acacaggtgggcgcctattttggcagcgccatcgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgccccctactactttgagcgaaagaaggaggtagggggc
gccatctacgtcttcatgaaccaggcaggcacctccttccctgcccacccctccctcctt
cttcatggccccagtcgctccgcctttggcttctccgtggccagcattggtgacatcaac
caggatggattccaggacattgctgtgggagctccatttgagggcttgggcacagtgtac
atctaccacagcagctccaggggtctcctccgacagccccagcaggtaatccacggagag
gacctgagactacctggcttggcctcctttggctactccctgagcggaaagatggatgtg
gatgagaacttctacccagacctgctagtagggagcctgtcagaccgcatcgtgctgctg
cgggccaggcctgtcatcaacatcctgcacaggaccttggaggccaggccatctgtgctg
gaccctgcgctctgcacagccacctcctgtgtgcaggtggagctgtgctttgcttacaga
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcttacactctggaggcc
gaccgggaccgccgcccaccccggcttcgctttgtgcagagccagtcagctgttttccac
ggcttcttctccatgcctgagatgcgctgccagaagctagagctgctcctgatggacaac
atccgtgacaaactccatcccatcgttatctccatgaactactctttacctctgcatttt
ccggagcgcccccggctggggatgcggtccctggacgcctaccctgtcctcaaccaggca
caggctctggagaaccacaccgaagtccagttccagaaggagtgcgggcaggacaacaag
tgcgacagcaacttgcagatgcaggcagccttcgtgtcggagcaggggcagcagatgagc
agactccagtacagtaaagacctcaggagactgctcctgagcatcaacgtgaccaacgct
ccaagcagggagcgggctggggaagatgcccacgaggcgctgctcaccctggcagttcct
cccgccctgctgctgtcctcagtgcgccctgctggagcttgccaggccaatgagaccatc
ctttgtgagctggggaatcccttcaaacagaaccagaggatggagctgctcatcgccttt
gaggtcattggggtgaccctgcacacaagggaactccaggcgcagctgcagctctccacg
tcaagtcaccaggacaacctgtggcccatgaccctaactctgctggtggactacacgctc
caggcctcactcagcatggtgagtcaccggctacaaagctactttggtggaacagtgatg
ggtgagtctggcatgaaaactgtggaggacgtgggaagccctctcaagtatgagttccag
gtgggcccaatgggagacgggctggcatccctggggaccctggtcctggggctggagtgg
ccctatgaagtcgccaatggcaagtggctgctgtaccccacggagatcaccatccaaggc
aatgggtcctggccctgccgaccaccaggagaccttattaaccctctcaacctcactctc
tctgtccctggggacagacggccatctccacagcgcaggcggcgacagctggacccaggg
ggaggccagggtcccccacctgttactctggctgctgccaaaaaagccaagtctgagacc
caattgagctgcggcagtgtgcacgcccgctgcgtgtggctggagtgccccatccccgat
gcccccgtcatcaccaacgtgacagtgcaggctcgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtcagggtagccagctgggccaccctgttcctccgaacc
agcatccccaccatcaacatggagaacaagaccgtgccgttctcggtagacattgactct
gagctcgtggaggagctgccagctgagatcgagctgtggctggtgcttgtgtctgtgggt
gccgggctgctgctgctggggatcatcatcctcctgctgtggaagtgtgacttctttaag
cggacccgctattaccagatcatgcccaagtaccatgcggtgcggatccgggaggaggaa
cgctacccacctccaggggggaccctgcccaccaagaagcactgggtgaccagctggcag
acatgggatcaatactactga

DBGET integrated database retrieval system