KEGG   Desmodus rotundus (common vampire bat): 112298997
Entry
112298997         CDS       T05907                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04110  Cell cycle
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05212  Pancreatic cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112298997 (E2F2)
   04218 Cellular senescence
    112298997 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112298997 (E2F2)
   05206 MicroRNAs in cancer
    112298997 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112298997 (E2F2)
   05225 Hepatocellular carcinoma
    112298997 (E2F2)
   05226 Gastric cancer
    112298997 (E2F2)
   05214 Glioma
    112298997 (E2F2)
   05220 Chronic myeloid leukemia
    112298997 (E2F2)
   05218 Melanoma
    112298997 (E2F2)
   05219 Bladder cancer
    112298997 (E2F2)
   05215 Prostate cancer
    112298997 (E2F2)
   05224 Breast cancer
    112298997 (E2F2)
   05222 Small cell lung cancer
    112298997 (E2F2)
   05223 Non-small cell lung cancer
    112298997 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112298997 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112298997 (E2F2)
   05161 Hepatitis B
    112298997 (E2F2)
   05160 Hepatitis C
    112298997 (E2F2)
   05163 Human cytomegalovirus infection
    112298997 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112298997 (E2F2)
   05169 Epstein-Barr virus infection
    112298997 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112298997 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112298997 (E2F2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    112298997 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 112298997
NCBI-ProteinID: XP_024409862
LinkDB
Position
Unknown
AA seq 439 aa
MLRGPWALAPAAGSSLKGLPAMSPTELWPTGLGSPQLCPVTTTYYTPLYPQTVPPAAVPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVLEFQTPKGKHIRVDGLPSPGW
APKSPGEKTRYDTSLGLLTKKFIYLLSESKDGVLDLNWAAEVLDVQKRRIYDITNVLEGI
QLIRKKAKNNIQWVGRGIFEDPTGPRKQQQLGQELKELTSTEQALDQLIQSCSLNFKHLT
EDKANKKLAYVTYQDIRAIGTFKEQTVIAVKAPPQTRLEVPERSEENLQIYLKSTQGPIE
VYLCPEEMQEPDSPAKEPIPSMPTLSPSPDSAQPSSSTNPGVLEPTASPAPSLTSQQDGV
LLPPPSLVPLEATDSMLELPYPLLQQTEDQLLPAALTDGSPLISFSPPPDQDDYLWGLDG
GEGISDLFDFYDFGDLLIN
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgttgcgagggccctgggccctggctccggccgctgggtcgtccctgaaggggctgccc
gcgatgagccccaccgaactgtggccgaccggcctcggcagcccccagctctgcccggtc
accaccacctactacaccccgctgtacccgcagactgtgcctccagccgcggtgcccggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggagggcattgggaggcccgcggtcctg
gaattccagacccccaaggggaagcacattagagtggatggcctccccagccctgggtgg
gcacccaagtcccctggggagaagactcggtatgacacatcgctggggctgctcaccaag
aagttcatttacctcctgagcgagtccaaggatggggtcctggacctgaactgggctgct
gaggtgctggacgtgcagaaacggcgcatctatgacatcaccaacgtgctggagggcatc
cagctcatccgcaagaaggctaagaataacatccagtgggtaggcaggggaatatttgaa
gaccccactgggcccaggaagcagcagcagctggggcaggagctgaaggagctgacgagt
acggagcaggccttggaccagctcatccagagctgctctctgaacttcaagcacctgacc
gaggacaaggccaacaagaaactggcctacgtgacttaccaggacatccgagctatcggc
acctttaaggaacagacggtgatcgctgtcaaggcccctccgcagacacgactggaagtg
cccgagaggagtgaggagaacctgcagatatacctgaagagcacgcaggggcccattgaa
gtctacctgtgcccggaggagatgcaggaaccagatagcccagccaaggaacccatcccc
tccatgcccaccctcagtcccagccctgactctgcccagcccagcagcagcaccaaccct
ggcgttctggaacccacggcatccccagcgccatcgctgacttcccagcaggacggtgtc
ctgctgccgccaccatcccttgtccctctggaggccactgacagcatgctggagctgcca
tacccgcttctgcagcagacggaggaccagctcctgcccgcagccctgacggacggctcc
cctctgatcagcttctctccgcccccggaccaggatgactacctgtggggcctggatggg
ggcgagggcatcagtgacctctttgacttctatgactttggggacctgctgattaattga

KEGG   Desmodus rotundus (common vampire bat): 112303722
Entry
112303722         CDS       T05907                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04110  Cell cycle
dro04137  Mitophagy - animal
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05212  Pancreatic cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112303722 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    112303722 (E2F1)
   04218 Cellular senescence
    112303722 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303722 (E2F1)
   05206 MicroRNAs in cancer
    112303722 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112303722 (E2F1)
   05225 Hepatocellular carcinoma
    112303722 (E2F1)
   05226 Gastric cancer
    112303722 (E2F1)
   05214 Glioma
    112303722 (E2F1)
   05220 Chronic myeloid leukemia
    112303722 (E2F1)
   05218 Melanoma
    112303722 (E2F1)
   05219 Bladder cancer
    112303722 (E2F1)
   05215 Prostate cancer
    112303722 (E2F1)
   05224 Breast cancer
    112303722 (E2F1)
   05222 Small cell lung cancer
    112303722 (E2F1)
   05223 Non-small cell lung cancer
    112303722 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112303722 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112303722 (E2F1)
   05161 Hepatitis B
    112303722 (E2F1)
   05160 Hepatitis C
    112303722 (E2F1)
   05163 Human cytomegalovirus infection
    112303722 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112303722 (E2F1)
   05169 Epstein-Barr virus infection
    112303722 (E2F1)
   05165 Human papillomavirus infection
    112303722 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112303722 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112303722 (E2F1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    112303722 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 112303722
NCBI-ProteinID: XP_024415029
LinkDB
Position
Unknown
AA seq 378 aa
MGAIAVASVIAWAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPTRGRGRHPGKG
VKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIH
LITKKSKNHIQWLGSHAAVGISGRLEGLTQDLQQLQENERQLDHLIHVCTTQLRLLSEDA
DSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQALDSSETFQISLKSKQGPIDVFLC
PEESAGGISPGKTPSQGAVSGEEDRTADPATTVPPSSSPPSTPDTDPSQSLLSLEQEPLL
SRTGGLRAPIDEDHLSPLVAADSLLEHVREDFSNLLPEEFISLSPPHGTLDYHFGLEEGE
GIRDLFDCDFGDITPLDF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgggcgccatcgccgtcgcttccgtcattgcctgggcaccccggcccacacccagcgcg
ccgcgccccgctctcggccgcccgccggtgaagcggaggctggacctggaaactgaccat
cagtacctggcggagagcagtgggccaacccggggaagaggccgccatccaggaaaaggt
gtgaagtctccaggggagaagtcacgctatgagacatctctgaatctgaccaccaaacgc
ttcctggagctgctgagccactcggctgatggcgttgtcgacctgaactgggcagctgag
gtgctgaaggtgcagaaacggcgcatctacgacatcaccaatgtccttgagggcatccac
ctcattaccaagaagtctaagaaccatatccaatggctaggcagccatgcagcggtgggg
atcagtgggcggcttgaaggactgacccaggacctccagcaactgcaggagaatgagcgg
cagttggaccacctgatccatgtgtgtaccactcaacttcggctgctctccgaggatgcc
gacagccaacgcctggcctatgtgacttgccaggaccttcgtagcattgcagaccctgca
gagcagatggttatggtaatcaaggcccctcccgagacccagcttcaagccctggactcc
tcagagacctttcagatctcccttaagagcaaacagggccccatcgatgttttcctgtgc
cctgaggagagtgccggcgggatcagccctgggaagaccccgtcccagggggcagtttct
ggggaggaagacaggacagctgatcctgccaccacagtgccaccatcatcatctccccct
tcaacccctgacacggatcccagccagtccctgctcagcctggagcaagaacctctgctt
tcccggacgggcggcctacgggcccccattgacgaggaccacctgtccccactggtggcg
gccgactcactcctggagcatgtgcgggaggacttctccaacctcctccctgaagagttc
atcagcctgtctcccccccatgggaccctcgactaccactttggccttgaggagggtgag
ggcatcagagacctctttgactgtgactttggggacattacccccctagatttctga

KEGG   Desmodus rotundus (common vampire bat): 112309256
Entry
112309256         CDS       T05907                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04110  Cell cycle
dro04218  Cellular senescence
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05212  Pancreatic cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112309256 (E2F3)
   04218 Cellular senescence
    112309256 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309256 (E2F3)
   05206 MicroRNAs in cancer
    112309256 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112309256 (E2F3)
   05225 Hepatocellular carcinoma
    112309256 (E2F3)
   05226 Gastric cancer
    112309256 (E2F3)
   05214 Glioma
    112309256 (E2F3)
   05220 Chronic myeloid leukemia
    112309256 (E2F3)
   05218 Melanoma
    112309256 (E2F3)
   05219 Bladder cancer
    112309256 (E2F3)
   05215 Prostate cancer
    112309256 (E2F3)
   05224 Breast cancer
    112309256 (E2F3)
   05222 Small cell lung cancer
    112309256 (E2F3)
   05223 Non-small cell lung cancer
    112309256 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112309256 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112309256 (E2F3)
   05161 Hepatitis B
    112309256 (E2F3)
   05160 Hepatitis C
    112309256 (E2F3)
   05163 Human cytomegalovirus infection
    112309256 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112309256 (E2F3)
   05169 Epstein-Barr virus infection
    112309256 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112309256 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112309256 (E2F3)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    112309256 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 112309256
NCBI-ProteinID: XP_024421228
LinkDB
Position
Unknown
AA seq 443 aa
MRRGIQPALEQYLVTAGAGEGATVVAAAAAAAPGAYIQILTTNTSTTSCSSSLQSGAVAA
GPILPSAPGVEQTTGSLLYTTPHGPSSRAGLLQQAPALGRGGSGGGGPPAKRRLELGESG
HQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVL
DLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKE
VTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPP
ETRLEVPDPLESLQIHLASTQGPIEVYLCPEETETHSPVKTNNQDHNGNIPKPTSKDLAS
TNSGHSDCSISMANLSPLASPTNLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEE
GISDLFDAYDLEKLPLVEDFMCS
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagaagggggatccagcccgccctggagcagtacctggtgaccgccggggcaggggag
ggggcgactgtcgtcgccgccgctgctgccgccgccccgggcgcgtacatccagatcctc
accacgaacacttccaccacctcctgttcctcctccctccaaagcggcgccgtcgccgcc
ggccccatcctccccagtgcccccggcgtggagcagaccaccggcagcctcctctacacc
acgccgcacggaccctccagcagagccgggctgctgcagcaggcaccagcgctaggacgc
ggcggcagcggcggtggcggccctccggccaagcgaaggctggagctaggagaaagcggt
catcagtacctctcagatggtttaaaaactccgaagggcaaggggagagctgcactgcga
agtccggacagtcccaaaactccaaaatctccctcagaaaaaacacggtatgatacatcc
cttggtctactcaccaagaagttcattcagctgctgagccagtcacctgatggggtcttg
gatttgaacaaggcagcagaggtgctgaaagtacagaagagaaggatttatgatatcacc
aacgtactggaaggcatccatctgattaagaagaagtctaaaaacaacgtgcaatggatg
ggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtcaaaggaa
gtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctg
gacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaa
gatatccgaaaaattagtggccttaaagaccaaactgtcatagttgtgaaagcccctcca
gaaacaagacttgaagtgcctgacccattagagagcctgcaaatacacttggcaagtacc
caaggacccattgaggtttacttgtgtccagaagagactgaaacacacagtccagtgaaa
acaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagacttggcttca
accaactcaggacatagcgattgctcaatttctatggcaaacctttctcctctggcctcc
cccaccaaccttttacagcagactgaggaccaaattccttccaacttagaaggaccattt
gtgaacttactgcctcccctgctccaagaagactatctcctaagtctcggggaggaagaa
ggcatcagcgatctcttcgatgcttatgatttggaaaagctcccactggtggaagacttt
atgtgtagttga

DBGET integrated database retrieval system