KEGG   Desmodus rotundus (common vampire bat): 112299108
Entry
112299108         CDS       T05907                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04066  HIF-1 signaling pathway
dro04072  Phospholipase D signaling pathway
dro04136  Autophagy - other
dro04140  Autophagy - animal
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04218  Cellular senescence
dro04371  Apelin signaling pathway
dro04613  Neutrophil extracellular trap formation
dro04630  JAK-STAT signaling pathway
dro04659  Th17 cell differentiation
dro04714  Thermogenesis
dro04910  Insulin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05022  Pathways of neurodegeneration - multiple diseases
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05221  Acute myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112299108 (MTOR)
   04371 Apelin signaling pathway
    112299108 (MTOR)
   04630 JAK-STAT signaling pathway
    112299108 (MTOR)
   04066 HIF-1 signaling pathway
    112299108 (MTOR)
   04072 Phospholipase D signaling pathway
    112299108 (MTOR)
   04151 PI3K-Akt signaling pathway
    112299108 (MTOR)
   04152 AMPK signaling pathway
    112299108 (MTOR)
   04150 mTOR signaling pathway
    112299108 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112299108 (MTOR)
   04136 Autophagy - other
    112299108 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    112299108 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112299108 (MTOR)
   04659 Th17 cell differentiation
    112299108 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112299108 (MTOR)
   04920 Adipocytokine signaling pathway
    112299108 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    112299108 (MTOR)
   04919 Thyroid hormone signaling pathway
    112299108 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    112299108 (MTOR)
   04213 Longevity regulating pathway - multiple species
    112299108 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    112299108 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112299108 (MTOR)
   05206 MicroRNAs in cancer
    112299108 (MTOR)
   05205 Proteoglycans in cancer
    112299108 (MTOR)
   05230 Central carbon metabolism in cancer
    112299108 (MTOR)
   05231 Choline metabolism in cancer
    112299108 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112299108 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112299108 (MTOR)
   05212 Pancreatic cancer
    112299108 (MTOR)
   05225 Hepatocellular carcinoma
    112299108 (MTOR)
   05226 Gastric cancer
    112299108 (MTOR)
   05214 Glioma
    112299108 (MTOR)
   05221 Acute myeloid leukemia
    112299108 (MTOR)
   05215 Prostate cancer
    112299108 (MTOR)
   05224 Breast cancer
    112299108 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112299108 (MTOR)
   05014 Amyotrophic lateral sclerosis
    112299108 (MTOR)
   05016 Huntington disease
    112299108 (MTOR)
   05017 Spinocerebellar ataxia
    112299108 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    112299108 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112299108 (MTOR)
   04931 Insulin resistance
    112299108 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112299108 (MTOR)
   05168 Herpes simplex virus 1 infection
    112299108 (MTOR)
   05163 Human cytomegalovirus infection
    112299108 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112299108 (MTOR)
   05165 Human papillomavirus infection
    112299108 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112299108 (MTOR)
   01522 Endocrine resistance
    112299108 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112299108 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112299108 (MTOR)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112299108 (MTOR)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112299108 (MTOR)
Membrane trafficking [BR:dro04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    112299108 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase Nipped-B_C HEAT_EZ
Other DBs
NCBI-GeneID: 112299108
NCBI-ProteinID: XP_024409994
LinkDB
Position
Unknown
AA seq 2549 aa
MLGTGPAAATAATTPSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
RDRMSFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSSLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGTFEFEGHSLT
QFVRHCADHFLNSEHKEVRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRFCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCVDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTGHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIAPEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHTSGANITNATTATSTAAATTTAMSTEGSNSESEAESSENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaacgggacctgccgccgccaccgcagctaccacgccgtctagcaatgtgagc
gtgctgcagcagttcgccagtgggctgaagagccgtaatgaggagaccagagccaaagct
gccaaggagctgcagcactacgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgcttctacgatcagctgaaccatcacatctttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaatcggccgattcgctaattatctccggaacctcctcccctctaatgaccca
gttgtcatggaaatggcatccaaagccattggtcgccttgccatggcaggggacactttc
actgctgaatatgtggagtttgaagtgaagcgagccctggagtggctgggtgctgaccgc
aacgagggccggagacacgcagctgttctggttctccgtgagctggcaatcagcgtcccc
accttcttcttccagcaagtgcagcccttcttcgacaacatttttgtggctgtgtgggac
cccaaacaggccatccgggagggggctgtagccgcccttcgtgcctgtctgattctcacc
acccagcgggagccgaaggagatgcagaagccccagtggtacaggcacacgtttgaagag
gcagagaaggggtttgatgagaccttggccaaggagaagggcatgaatcgggatgatcgg
atccatggagctttgctgatcctcaacgagctggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaggaaatcacgcagcagcagttggtacacgacaagtactgc
agggaccgcatgagcttcgggacgaaacctcgtcacatcacccccttcaccagcttccag
gctgtgcagccccagcagtccaacgccttggtgggactcctggggtacagctctcaccaa
ggcctcatggggtttggggcgtcccccagcccagccaagtccagcctggtggagagccgg
tgttgcagagacttgatggaggagaagttcgatcaggtgtgccagtgggtgctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgctaccccgcttggct
gcattccgaccttccgccttcacagatacccagtacctccaggataccatgaaccacgtc
ctaagctgcgtcaagaaggagaaggaacgtacagcagccttccaggccctggggctgctt
tctgtggctgtgaggtctgagtttaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgcccccaaaggacttcgcccataagagacagaaggcaatgcaggtggatgcc
acggtgttcacctgcatcagcatgctggctcgagccatggggccaggcatccagcaggat
atcaaggagctgctggagcctatgctggcagtgggactgagccccgccctcacagctgtg
ctctacgacctgagccgtcagattccgcagctgaagaaggacatccaggatgggctactg
aagatgctgtccctggtccttatgcacaagcccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcttcccctggccttacaaccctccctgaggccagtgatgtgggc
agcattactcttgccctccgaactcttggcacctttgaatttgaaggacactctctgacc
cagtttgtccgccactgtgcggaccatttcctgaacagtgagcacaaggaggtccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctctgtccacctcatcagcggccac
gctcacgtggtcagccaaaccgcagtgcaagtggtggcagacgtgctcagcaagctgctc
gtggtcgggataacagaccctgaccccgacattcgcttctgtgtcttggcgtccctggat
gagcgcttcgatgcgcacctggcccaggcagagaatttgcaggccctgttcgttgccctg
aatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaatccagccttcgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggaacacagtggtattggaagaatcaaagagcagagtgcccgcatgctgggccacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaggacccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaattggagagttggctcaggttagtggcctagaaatgaggaaatgggttgatgagctt
tttattatcatcatggacatgctccaggattcttctctgttggctaaaaggcaggtggcc
ctgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacagaaag
taccccacgttgcttgaggtgctgctgaatttcctgaagacggagcagaaccagggtaca
cggagggaggccattcgggtgttagggctcttgggggccttggatccctacaagcacaaa
gtgaacatcggcatgattgaccagtcccgggatgcttctgcggtcagcctgtcggaatcc
aagtcaagtcaggattcctctgactacagcaccagtgagatgctggtcaacatgggaaac
ctgcctctggacgagttctaccccgccgtgtccatggtggccctgatgcggatcttccga
gaccagtccctgtctcaccaccacaccatggttgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtgatgcccacattcctcaacgtc
attcgggtctgtgatggggccatccgggaatttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggacgaaattgtcaccctcatgagagaa
ttctgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaatcgtg
gtcgctcttggaggtgaatttaagctctacctgccccagctgatcccgcacatgctacgg
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaagttgctggctgccatc
cagctctttggcgccaacctggacgactacctgcatttgttgctgccccccatcgtgaag
ctgtttgatgcccccgaagttccactgccatctcgaaaggcggctctggagacggtcgac
cgcctgacggaatccctggatttcacggactacgcctcccggatcattcacccaatcgtt
cgaaccctggaccagagcccagagctgcgtcccacagccatggacacgctgtcttccctt
gtctttcagctggggaagaagtaccagattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaaccatcagcgctatgacgtcctcatctgcagaattgtcaagggctac
accctggctgatgaagaggaggaccctttgatttaccagcatcgaatgctgaggagcggc
caaggggatgcattggctagtggaccagtggaaacgggacccatgaagaaactgcacgtc
agcaccatcaaccttcaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ctggagtggctgaggcggctgagcctggagctgctgaaggactcctcgtcgccctcgctg
cgctcctgctgggccctggctcaggcctacaacccgatggccagggacctcttcaacgcc
gcctttgtgtcctgctggtccgagctgaatgaagaccagcaggacgaactcatccgaagc
atcgagttggccctcacctcacaggacattgctgaagtcacacagaccctcttaaacttg
gctgaattcatggagcacagtgacaagggccccctgccattgagagacgacaatggcatt
gttttgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctgcactacaaa
gaactggagttccagaaaggtcccacccccgccatcctagagtctctcatcagcattaat
aataagctacagcagccggaggcagctgccggggtgctagaatacgccatgaaacacttc
ggagagctggagatccaggccacctggtatgagaagctgcacgagtgggaggatgccctt
gtagcctatgataagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggagaatgggggcagctgcaccagcaatgctgtgaaaag
tggaccctggtcaatgatgagacccaagccaagatggcccggatggctgctgccgctgcc
tggggtttaggtcagtgggacagcatggaggagtacacctgtatgatccctcgggacacc
cacgatggagcattttacagagccgtgcttgcactacaccaggacctcttctccctggca
cagcagtgcgtcgacaaagccagggacctgctggatgccgagttaaccgctatggcagga
gagagctacagtcgggcatatggggccatggtttcctgccacatgctgtctgagctggag
gaggtgatccagtacaaacttgtccccgagcgacgtgagatcatccgccagatctggtgg
gagaggctgcagggctgccagcgcatcgtggaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagcccccacgaggacatgaggacctggctcaagtatgcaagcctgtgt
ggcaagagcggcaggctggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccatctcggcaacttgaccatcctctgccaacaggacaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagtgctcgcaagatcgacgccttccagcacatgcagcacttt
gtgcagacgatgcagcagcaggcccagcacgccatcgcccccgaggaccagcagcacaag
caggagctgcacaagctcatggcccggtgtttcctgaaacttggggagtggcagctgaac
ctccagggcatcaatgagagcacaatccccaaagtcctgcagtactacagcgccgccacg
gagcatgaccgcaactggtacaaggcctggcacgcgtgggctgtcatgaacttcgaggct
gtgctccactacaagcaccagaaccaagcccgcgacgagaaaaagaagctgcgtcacacc
agcggggccaacatcaccaacgcgaccactgccaccagcacagcagctgccaccaccact
gccatgagcaccgagggcagcaacagcgagagcgaggctgagagcagcgagaacagtcct
acgccctcgcctctgcagaagaaggtcactgaggacctctccaaaaccctcttgatgtac
actgtccccgccgtccagggcttcttccgttctatctccttgtcacgaggcaacaacctc
caggacacgctcagggtcctcaccttatggtttgattatggccactggccagatgtcaat
gaagccttagtggagggggtgaaggcgatccagattgacacttggttacaggtcatacct
cagctcattgcaagaattgatacacccaggcccttggtgggacgcctcattcaccagctg
ctcacagacattggtcggtaccacccccaggccctcatctaccccctgactgtggcctct
aagtctacgaccacagcccgccacaacgcagccaacaagattctgaagaacatgtgtgag
cacagtaacaccctggtgcagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctctggcacgagatgtggcacgaaggcctggaagaagcgtctcgtctgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggaacccctgcatgcgatgatggaacgg
ggaccccagactctgaaggaaacgtcctttaaccaggcatatgggcgagacttaatggag
gcccaggagtggtgcaggaagtacatgaaatcggggaatgtcaaggacctcactcaggcc
tgggacctctattaccacgtgttcagacgaatctcaaagcagctgcctcagctcacatcc
ttggagctgcagtacgtttcccccaaacttctgatgtgccgagaccttgagttggctgtg
ccgggaacgtacgaccccaaccagccgatcattcgcattcagtccatagcaccgtccctg
caagtcatcacctccaagcagaggccccggaagctgacactaatgggcagcaacgggcat
gagttcgttttcctcctgaagggccacgaggacctgcggcaggatgagcgggtgatgcag
ctcttcggcctggtcaacaccctgctggccaacgacccgacgtccctccggaagaatctc
agcatccagagatacgcagtcattcctttatcgaccaactcgggcctcatcggctgggtc
ccccactgtgacacgctgcatgccctcatccgggactacagggagaagaagaagatcctc
ctcaacattgagcaccgcatcatgttgcggatggctccggactacgaccacctgactctg
atgcagaaggtggaggtgtttgagcacgccgtcaataacactgccggggacgacctggcc
aagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaattac
acccgctcgttagccgtcatgtccatggtcgggtatattctgggcctgggagataggcac
ccgtccaacctgatgctggaccggctgagcgggaagattctacacattgactttggggac
tgctttgaggttgctatgaccagagagaagttcccagaaaagattccatttagactgaca
agaatgttgaccaatgctatggaggttaccggtctggacggcaactacagaatcacgtgc
cacacggtgatggaggtgctccgggaacacaaggacagcgtcatggccgtgctggaagcc
ttcgtctacgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatcccgaacaaggacagattcctactctgctggccagtcagtagaaattctggatggt
gtggaacttggggaaccagcccacaagaaaaccgggaccacagtgccagaatctattcat
tctttcatcggagatggtctggtcaaaccagaggccctaaataagaaagctattcagatc
attaacagagtccgagataagctcactggtcgggacttctctcatgatgaaactttggat
gtcccgacacaagtcgagctgctcatcaaacaagcaacgtcccatgaaaacctctgccag
tgctacattggctggtgtcctttctggtga

DBGET integrated database retrieval system