KEGG   Desmodus rotundus (common vampire bat): 112299456
Entry
112299456         CDS       T05907                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04370  VEGF signaling pathway
dro04919  Thyroid hormone signaling pathway
dro05010  Alzheimer disease
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05134  Legionellosis
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05215  Prostate cancer
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112299456 (CASP9)
   04151 PI3K-Akt signaling pathway
    112299456 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112299456 (CASP9)
   04215 Apoptosis - multiple species
    112299456 (CASP9)
   04115 p53 signaling pathway
    112299456 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112299456 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112299456 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112299456 (CASP9)
   05212 Pancreatic cancer
    112299456 (CASP9)
   05215 Prostate cancer
    112299456 (CASP9)
   05213 Endometrial cancer
    112299456 (CASP9)
   05222 Small cell lung cancer
    112299456 (CASP9)
   05223 Non-small cell lung cancer
    112299456 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112299456 (CASP9)
   05012 Parkinson disease
    112299456 (CASP9)
   05014 Amyotrophic lateral sclerosis
    112299456 (CASP9)
   05016 Huntington disease
    112299456 (CASP9)
   05020 Prion disease
    112299456 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    112299456 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112299456 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112299456 (CASP9)
   05152 Tuberculosis
    112299456 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112299456 (CASP9)
   05161 Hepatitis B
    112299456 (CASP9)
   05160 Hepatitis C
    112299456 (CASP9)
   05164 Influenza A
    112299456 (CASP9)
   05162 Measles
    112299456 (CASP9)
   05168 Herpes simplex virus 1 infection
    112299456 (CASP9)
   05163 Human cytomegalovirus infection
    112299456 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112299456 (CASP9)
   05169 Epstein-Barr virus infection
    112299456 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112299456 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112299456 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dro01009]
    112299456 (CASP9)
   01002 Peptidases and inhibitors [BR:dro01002]
    112299456 (CASP9)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     112299456 (CASP9)
Protein phosphatases and associated proteins [BR:dro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112299456 (CASP9)
Peptidases and inhibitors [BR:dro01002]
 Cysteine peptidases
  Family C14: caspase family
   112299456 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 112299456
NCBI-ProteinID: XP_024410475
LinkDB
Position
Unknown
AA seq 452 aa
MDRADRQLLRRCRVQLVGELQVADLWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSRALPLFISCLEETGQHSLASLLRTSSQAAKRDPEAIRPWDLMPVVVGPVGLKP
EELRVVKQDPPKPTPGKLTPVVLGPEELCPAKLRPEVLRPDVPRPVDVPSGGSADDRAQE
RSRGRADLAYVLNADPCGHCLILNNVNFSLKSGLSTRSGSNVDCEKLRRRFHLLHFEVEV
KCDLTAKQMVQALVELSRRDHGALDCCVVVILSHGCQASHLQFPGAIYGVDGGPVSIEKI
VNIFNGTGCPSLRGKPKLFFIQACGGDQRDRGFEVVSTGPEDRAPGSSPEPDAAPFLDKP
GDCDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDPNSGSWYVETLDGVFEQWAHCEDLQSL
LLRVAHAVSEKGVYKQIPGCFNFLRKKLFFRT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggaccgggctgaccgacagctcctgcggcgatgccgggtgcagctcgtgggcgagttg
caggtggccgatctctgggacgctctgctgaaccgagagctcttcacgccggacatgatc
gaagacatccagagggcgggctccgggtctcggcgcgatcaggccaggcagctgatcaca
gatctggagactcgagggagtcgggcccttcctttgttcatctcctgcttggaggaaaca
ggacaacacagcctggcgtcattgctgagaacaagtagccaagctgcaaagcgggatccg
gaggccatcagaccctgggacctcatgcctgtggtggtcggacccgtggggctcaaacca
gaggagctgagagtggtgaagcaggacccaccgaagccgaccccaggcaaactcactcca
gtagtgctggggccagaagagctctgtcctgccaagctcagaccagaggttctcagaccg
gatgtgcccaggccagtggatgttccttctggaggatccgctgacgaccgtgctcaggaa
agatcgaggggaagagctgatttggcctacgtcctgaatgcagacccctgtggccactgc
ctcatcctcaacaacgtgaacttctccctgaagtccgggctcagcacccgctccggctcc
aatgtcgactgcgagaagttgcggagacgcttccacttgctgcacttcgaggtggaggtg
aagtgcgacctgactgccaagcaaatggtccaggctctggtggagctgtcgcggcgggac
catggtgccctggactgctgtgtggtggtcatcctctctcatggttgtcaggccagccac
ctccagttccccggggccatttatggcgtagatggcggtcctgtgtccattgagaaaatc
gtgaacatcttcaatggaaccggctgccccagcttgagagggaagcccaagctctttttc
atccaggcctgtggtggagatcagagagaccgtgggtttgaggtggtctccactggtcct
gaggacagggcccctggcagtagcccggagccggatgctgccccattcctggacaagcca
ggcgactgtgaccagccagatgctgtgtccagtttgcccacaccaagtgacatctttgtg
tcttactccaccttcccagggtttgtctcctggagggatcccaacagtggctcttggtat
gtggagaccctggatggcgtttttgagcagtgggctcactgtgaagacctgcagagcctc
ctgctcagggtcgctcatgctgtttcggagaaaggggtttacaagcagatccccggttgt
ttcaatttcctccggaaaaaactcttctttcgaacttag

DBGET integrated database retrieval system