KEGG   Desmodus rotundus (common vampire bat): 112299769
Entry
112299769         CDS       T05907                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112299769 (CREB3L2)
   04024 cAMP signaling pathway
    112299769 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    112299769 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    112299769 (CREB3L2)
   04152 AMPK signaling pathway
    112299769 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112299769 (CREB3L2)
   04922 Glucagon signaling pathway
    112299769 (CREB3L2)
   04915 Estrogen signaling pathway
    112299769 (CREB3L2)
   04926 Relaxin signaling pathway
    112299769 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    112299769 (CREB3L2)
   04918 Thyroid hormone synthesis
    112299769 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    112299769 (CREB3L2)
   04916 Melanogenesis
    112299769 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    112299769 (CREB3L2)
   04927 Cortisol synthesis and secretion
    112299769 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112299769 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112299769 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    112299769 (CREB3L2)
   04728 Dopaminergic synapse
    112299769 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    112299769 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    112299769 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112299769 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    112299769 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112299769 (CREB3L2)
   05020 Prion disease
    112299769 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    112299769 (CREB3L2)
   05031 Amphetamine addiction
    112299769 (CREB3L2)
   05034 Alcoholism
    112299769 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112299769 (CREB3L2)
   04934 Cushing syndrome
    112299769 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112299769 (CREB3L2)
   05161 Hepatitis B
    112299769 (CREB3L2)
   05163 Human cytomegalovirus infection
    112299769 (CREB3L2)
   05165 Human papillomavirus infection
    112299769 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112299769 (CREB3L2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112299769 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 112299769
NCBI-ProteinID: XP_024410781
LinkDB
Position
Unknown
AA seq 520 aa
MEVPESGEQSVLQWDRKLSELSEPGDTEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLSEEPRAQSPFTHVTSSDSFNDDDTESEKWYLSADF
PSATIKTEPITEDSPPGLVPSGTLTITAISTPFEKEEPPLEMNTGVDSSCQTVIPKIKLE
PHEVDQFLNFSSKEASVDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFGLPQTHGPARAVP
RAPSTLSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSASKMALPSQQSVPEPYA
ASVVKSRNLLIYEEHSPLEEPSSPASAGELGRWDRSPSLLRASALESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSANLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgcccgagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacaccgaggctctcatgtatcacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggccagctcctgaacgaccctttcctctcagagaag
agcgtgtccatggaggtggagccgtcccccacatcccccgcgcctctcatccaggccgag
cacagctactccctgagtgaggagcctcgggcgcagtcgccgttcacccacgtgaccagc
agcgacagcttcaatgacgacgacacagaaagcgagaaatggtacctgtcagcagacttc
ccttcagccaccatcaagaccgagcccattacggaggattcgcccccaggacttgttccg
tcaggcactctgaccatcacggccatctccaccccttttgaaaaggaggaaccgcctttg
gaaatgaacactggggttgattcctcgtgccagacagtcatccctaagattaagctggag
cctcatgaggtggatcagttcctcaacttctcttctaaagaagcctccgtggaccacctg
cacctgccgcccaccccgcccagcagccacagcagtgactcggagggcagcctgagcccc
agcccgcgcctgcaccccttcggcctgcctcagacccacggccccgccagggccgtgccg
cgggccccctccaccctttccagttccccgctcctcaccgcgcctcacaaactgcagggc
tcaggcccactggtcctgacagaggaggagaagaggaccctgatcgccgagggctacccc
atccccaccaaactgcccctgacaaaatcagaggagaaggcgctgaagaaaatcaggagg
aaaatcaagaataagatttctgcccaggaaagtaggagaaagaagaaagagtacatggac
agcttggagaaaaaggtggagtcttgttccacggagaacctggagcttcggaagaaggtg
gaggtgctggagaacaccaacaggactctcctccagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgtaagctggccggcacgcagactggcacctgcctc
atggtcgttgtgttatgctttgctgtggccttcggcagcttcttccagggctacgggccc
tatccttctgccagcaagatggctctgcccagccagcagtccgtgccggagccgtacgca
gcctccgtggtgaagtccaggaacctgctcatctacgaggaacattcacccctggaggag
ccgtccagcccggcctcagccggggagcttgggcgctgggacagaagcccctccctgctc
agggcatcagcgctggagtccaggccggatgtggatcttccccacttcatcatctccaac
gagacaagtctggagaagtccgtgctgttggagctgcagcagcacctggtcagcgccaac
ctggagggaaatgaaacactcaaagttgtagaactcgacagaagagtgaacgccaccttc
tga

KEGG   Desmodus rotundus (common vampire bat): 112302085
Entry
112302085         CDS       T05907                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04141  Protein processing in endoplasmic reticulum
dro04151  PI3K-Akt signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04918  Thyroid hormone synthesis
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112302085 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112302085 (ATF6B)
   04022 cGMP-PKG signaling pathway
    112302085 (ATF6B)
   04151 PI3K-Akt signaling pathway
    112302085 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112302085 (ATF6B)
   04915 Estrogen signaling pathway
    112302085 (ATF6B)
   04926 Relaxin signaling pathway
    112302085 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    112302085 (ATF6B)
   04918 Thyroid hormone synthesis
    112302085 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    112302085 (ATF6B)
   04925 Aldosterone synthesis and secretion
    112302085 (ATF6B)
   04927 Cortisol synthesis and secretion
    112302085 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112302085 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112302085 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    112302085 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112302085 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    112302085 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    112302085 (ATF6B)
   05031 Amphetamine addiction
    112302085 (ATF6B)
   05034 Alcoholism
    112302085 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112302085 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302085 (ATF6B)
   05161 Hepatitis B
    112302085 (ATF6B)
   05163 Human cytomegalovirus infection
    112302085 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112302085 (ATF6B)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112302085 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DUF4407 bZIP_Maf GIT_CC YabA NYD-SP28_assoc Docking
Other DBs
NCBI-GeneID: 112302085
NCBI-ProteinID: XP_024413399
LinkDB
Position
Unknown
AA seq 699 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDCTLYTGLDEVAEEQTQLFRCPEKDVPFGSSML
DVGMDVSPPEPPWDPLPLFPDLQVKSEPSSPRSNSSLSSESSRHSAEPSSQTPGVGEVLV
VKIESLAPPLCLLGDDPASLIETVQVNVGPTSDDPSDVQTKVEPVSPSSSINSEASLFSA
ESPSQAFIGEEILEVKTESPAPQGCLLRDVAGPPLGAVQIRVGPSDGSSGKALPARKPPL
QPKPVVITTVPVPPSAMPPSTTVLLQPLVQPPPVSPVVLLQGAIQVQPEGPAPPAPRPER
KSIVPAPMPGSSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLESRLQAVLADN
QQLRRENAALRRRLEALWAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPSATV
SPWMSGEEHRPRRHLLEFSAQLPIHGVEPLQGSSQGPEELQPRREGQPSFRNLTAFPGNA
KELLLRDLDHLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPRGAQKRQKSQRRK
NLPPVQAVPTQSPGPPERDSAGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLL
PAISHNKTSRPKMSLVMPAMAPNETLSGQGALGDYEEMMQIECEVMDTRVIHIKTSTVPP
SLRKQPSSTPGNATGGPLPASAAGQAHRATHRPFYLNHP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggagctaatgctcctcagcgaaattgcggacccgacgcgatttttcaccgacaac
ttgctgagcccggaggactgggactgcacgctgtacaccggcctggatgaggtggccgag
gagcagacgcagctcttccgttgcccggagaaggatgtcccgtttggcagcagcatgctg
gatgtggggatggatgtcagcccccccgaacccccgtgggaccccctgcctcttttccca
gatctacaggtgaagtctgagccatcttctccccgctccaactcctctctcagctccgaa
tcatcccgtcactctgcagagccctccagccagacccctggtgtaggggaggtgctggtt
gtgaagatagagtccttggcccccccgctctgcctcctgggagatgatccggcctccctc
atcgaaaccgtccaggtcaatgtgggccccacctccgatgatccctcagatgtccagacc
aaggtggagcctgtctccccatcttcctccatcaactctgaggcttccttgttctcagca
gagtcccccagccaggcgtttataggagaggaaatactagaagtgaagacagagtcccca
gcccctcaagggtgcctcctgcgggatgtcgcaggtcccccacttggagctgttcagatc
agagtgggtccgtccgatggctcctcaggcaaagccctgcctgcccggaagccaccactg
cagcctaaaccagtggtgataactactgtcccagtgccacccagcgccatgcctcccagc
accaccgtccttttgcagccccttgtccagccccctccagtgtccccagttgtccttctt
caaggtgctattcaagtccagcctgaggggccggccccccctgctccacggcctgagagg
aagagcattgttccagctcctatgcctgggagctcctgcccacctgaagtggacgcaaag
ctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcttgccagtccaggagg
aagaagaaggagtacctgcaggggctggagtctcggctacaggctgtgctcgccgacaac
cagcagctgcgccgcgagaacgctgccctccgccggcggctggaggccctgtgggctgag
aacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttcctt
ctcttcattgctttcaactttgggcctgtcagcatcagtgagcctccttcagctactgtc
tctccttggatgagcggagaggagcatcgaccccggagacacttgctggagttctcagca
cagttgcccattcatggagttgagcccctccagggctcctcccagggccccgaggagctg
cagccccgccgggagggccagccgagcttcaggaacctgacagccttccccgggaacgcc
aaggagctgctgctgagagacctggaccacctcttcctctcctcggattgccggcacttc
aaccgaactgagtccctgaggcttgctgatgagctgagcggctgggtgcagcgccaccag
agaggccggcggaagatgccccggggggcccagaagagacagaagtctcagcggcggaag
aatttgcctccagttcaggcagtccccacccaatcccccgggcccccggaaagggattct
gcgggccaactgcagctgtatcgccacccagaccgttcacagccagagttcctggatgca
attgaccgacgggaagacacgttttatgtggtctccttccggcgggaccacctgctactc
ccagccatcagccacaataagacctctcggcccaagatgtccctggtgatgcctgccatg
gcccccaatgagaccctgtcaggccagggggcccttggggactatgaggagatgatgcag
atcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgcccccc
tcgctccgaaaacagccgtcttcgaccccgggcaatgccacaggtggccccttgccagct
tctgcagccggccaggcccaccgggccacccatcggcccttctacctcaatcacccctga

KEGG   Desmodus rotundus (common vampire bat): 112303463
Entry
112303463         CDS       T05907                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112303463 (CREB3L1)
   04024 cAMP signaling pathway
    112303463 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    112303463 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    112303463 (CREB3L1)
   04152 AMPK signaling pathway
    112303463 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112303463 (CREB3L1)
   04922 Glucagon signaling pathway
    112303463 (CREB3L1)
   04915 Estrogen signaling pathway
    112303463 (CREB3L1)
   04926 Relaxin signaling pathway
    112303463 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    112303463 (CREB3L1)
   04918 Thyroid hormone synthesis
    112303463 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    112303463 (CREB3L1)
   04916 Melanogenesis
    112303463 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    112303463 (CREB3L1)
   04927 Cortisol synthesis and secretion
    112303463 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112303463 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112303463 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    112303463 (CREB3L1)
   04728 Dopaminergic synapse
    112303463 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    112303463 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    112303463 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112303463 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    112303463 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112303463 (CREB3L1)
   05020 Prion disease
    112303463 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    112303463 (CREB3L1)
   05031 Amphetamine addiction
    112303463 (CREB3L1)
   05034 Alcoholism
    112303463 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112303463 (CREB3L1)
   04934 Cushing syndrome
    112303463 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112303463 (CREB3L1)
   05161 Hepatitis B
    112303463 (CREB3L1)
   05163 Human cytomegalovirus infection
    112303463 (CREB3L1)
   05165 Human papillomavirus infection
    112303463 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112303463 (CREB3L1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112303463 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 112303463
NCBI-ProteinID: XP_024414826
LinkDB
Position
Unknown
AA seq 548 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQGAGAATSWGG
GLWAPSRKRGDVCQPRGPDMERGAWVLGHKLCSVMVKQEQSLELPVDPLAASSAMAATAA
MATTPLLGLSPLSRLPIPHQAPAEMTQLPVIKAEPQEVNQFLKVTPEDLVQMPPTPPSSH
GSDSDGSQSPRSLPPSSPVRPMARSSTAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIA
EGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNEL
WKKVETLENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVLGSLVP
CLPEFSSGSQTVKEDPVATDSVYAASQMPSRSLLFYDEGTGSWEDGRSALLPVEPPDGWE
IKPGGPAEQRPQDHLQHDHLDSTHETTKYLSEAWPKDVGGNGSSPDFSHPKEWFHDRDLG
PNTTIKLS
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggacgcggtcttggagcccttccctgccgacagactgttcccgggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcatttccctgagcacctg
gaccacttcgcggagaacatggaggacttctccaacgacctgttcagcagtttcttcgat
gaccccgtgctggatgagaagagccctctcctggacatggaactggactcgcccacgcca
ggcatccaggctgagcacagctactccctgagcggtgactcagcgcctcagagccccctc
gtgcccatcaagatggaggacaccacccaaggtgctggggccgccacaagctggggtgga
ggactgtgggcacccagcaggaaaaggggtgatgtctgccagccccgtggcccagacatg
gagcgtggagcctgggtgctgggacacaagctgtgctccgtcatggtgaagcaggagcag
agcctggagctgcctgtggaccctctggccgcctcctcagccatggccgccactgccgcc
atggccaccaccccgctgctgggcctcagccccctgtccaggctgcctattccccaccag
gccccggcagagatgactcagcttccagtgatcaaagcagagccccaggaggtgaaccag
ttcctcaaagtgacaccagaggacctggtgcagatgcctccgacgccccccagcagccat
ggaagtgacagtgacggctcccagagtccccgctctctgcccccctccagccctgtccgg
cccatggcccgctcttccacagctatctccacctcgcccctcctcacagcccctcacaaa
ttacaggggacttcagggccactgctcctgacggaggaggagaagcgcaccctgattgct
gagggctaccccatccccacgaaactccccctcaccaaagccgaggagaaggccttgaag
agggtccgcaggaaaatcaagaacaagatctcggcccaggagagccgccgtaagaagaag
gaatacgtggagtgtctagaaaaaaaggtggagacattcacatcagagaacaacgaactg
tggaagaaggtggagaccctggagaatgccaacaggaccctgctgcagcagctgcagaaa
ctccagactctggtcaccaacaagatctcccgaccttacaagatggccgccacccagacc
gggacctgcctcatggtggcagccctgtgcttcgttctggtgctgggctccctcgtgccc
tgcctccctgagttctcctctggctcccagactgtgaaggaagaccccgtggccactgac
agcgtctacgcagccagtcagatgccctcccgaagcctcctgttctacgatgaggggaca
ggctcttgggaagatggacgcagtgctctgctgcctgtggagcccccggatggctgggaa
atcaagcctggggggccagcggagcagcggccccaagaccacctacagcatgaccacctg
gacagcacccacgagaccacaaagtacctgagcgaggcctggccaaaagacgtcggtgga
aacggcagcagccccgacttctcccaccccaaggagtggttccacgacagggatctaggc
ccgaacaccaccatcaagctctcctag

KEGG   Desmodus rotundus (common vampire bat): 112304550
Entry
112304550         CDS       T05907                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112304550 (CREB3)
   04024 cAMP signaling pathway
    112304550 (CREB3)
   04022 cGMP-PKG signaling pathway
    112304550 (CREB3)
   04151 PI3K-Akt signaling pathway
    112304550 (CREB3)
   04152 AMPK signaling pathway
    112304550 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112304550 (CREB3)
   04922 Glucagon signaling pathway
    112304550 (CREB3)
   04915 Estrogen signaling pathway
    112304550 (CREB3)
   04926 Relaxin signaling pathway
    112304550 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    112304550 (CREB3)
   04918 Thyroid hormone synthesis
    112304550 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    112304550 (CREB3)
   04916 Melanogenesis
    112304550 (CREB3)
   04925 Aldosterone synthesis and secretion
    112304550 (CREB3)
   04927 Cortisol synthesis and secretion
    112304550 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112304550 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112304550 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    112304550 (CREB3)
   04728 Dopaminergic synapse
    112304550 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    112304550 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    112304550 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112304550 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    112304550 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112304550 (CREB3)
   05020 Prion disease
    112304550 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    112304550 (CREB3)
   05031 Amphetamine addiction
    112304550 (CREB3)
   05034 Alcoholism
    112304550 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112304550 (CREB3)
   04934 Cushing syndrome
    112304550 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112304550 (CREB3)
   05161 Hepatitis B
    112304550 (CREB3)
   05163 Human cytomegalovirus infection
    112304550 (CREB3)
   05165 Human papillomavirus infection
    112304550 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112304550 (CREB3)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112304550 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 112304550
NCBI-ProteinID: XP_024415959
LinkDB
Position
Unknown
AA seq 407 aa
MELALDPGDQDLLGFLLEESGGLGAVPDEVLEAPLDWELPLSEVGGVSVGEVKGGDESRT
VNLNPVKALSDWDIEDFLSSLPSPPASLSILSNSNPRLVHHDHTYSLPQEHVSIDLDGGV
CGTEETQMTPLHVEEPAEQEIVRLTLTDEEKRLLEQEGLTLPGTLPLTKMEEQVLKRVRR
KIRNKKSAQESRRKKKVYVGVLESRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAM
VIQIANKTSSSSTCLLVRMVNEVKIIVPGAGMGAIQSSSSFPFPVLQVLLFSLCLVFVPA
MYSSDTRGSLPAEHGVLSRQLRALPQQLELSALQSEVPKDSSDRELQAPGNSCCPLFHMP
RAPGPEPPLKLPCPGPIFPLHANLTREGGWLHAHRPISVILQGGYSG
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggagttggcgttggaccccggtgatcaggacctgttgggcttcctgctagaggaaagc
ggaggtttgggggcggtgcccgacgaggtcttggaggctccactggactgggagttgccg
ctttctgaggtgggtggggtctcagtcggggaggtcaagggtggtgacgagtcgaggact
gttaatttgaatcctgtgaaggccctcagcgattgggacatagaggatttcctgagctcc
ctgccaagtcctccagcgtcgttgagcattctcagcaactctaacccccgtcttgtccac
catgatcacacctactctctcccacaagaacatgtttccatagatctagatggtggggtc
tgtggaacagaggagactcagatgactccactgcatgtggaggagccggcagagcaggag
attgttaggcttacactgacagatgaggagaagaggctgttggagcaggaagggcttact
ctgcctgggacacttcctctcactaagatggaggaacaagttctgaaacgagtgcggagg
aagattcgaaataaaaagtcggctcaagagagccgcaggaagaagaaggtgtacgtgggg
gtgttagagagcagggtcttaaaatacacagcccagaatctggaactacagaacaaagta
cagctcctggaggaacaaaatctgtccctcctggatcagttgaggcggctccaggccatg
gtcattcagatagcaaacaaaaccagcagcagcagcacctgtctcttggtgaggatggtg
aatgaagtaaagatcattgtcccaggtgcagggatgggtgcaatccagagctcttcgtca
tttccttttcctgtgctccaggtcctcctgttctccctctgtctcgtctttgtacctgct
atgtactcctctgacacaagggggagcctgccagctgagcatggagtgttatcccgccag
cttcgtgccctccctcagcagctggagctgtctgccctgcagtcggaggtaccaaaggat
agctctgaccgtgagctccaggctcctggcaactcttgctgcccgctcttccacatgcct
cgggctcctggcccagagcctcccctgaagttgccctgcccaggtcccatttttcccctg
catgcaaatctcacaagagaggggggatggctccatgcccacagacccatatctgttatc
ttgcagggtggatactcaggctag

KEGG   Desmodus rotundus (common vampire bat): 112305718
Entry
112305718         CDS       T05907                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112305718 (ATF2)
   04668 TNF signaling pathway
    112305718 (ATF2)
   04022 cGMP-PKG signaling pathway
    112305718 (ATF2)
   04151 PI3K-Akt signaling pathway
    112305718 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112305718 (ATF2)
   04922 Glucagon signaling pathway
    112305718 (ATF2)
   04915 Estrogen signaling pathway
    112305718 (ATF2)
   04926 Relaxin signaling pathway
    112305718 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    112305718 (ATF2)
   04918 Thyroid hormone synthesis
    112305718 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    112305718 (ATF2)
   04925 Aldosterone synthesis and secretion
    112305718 (ATF2)
   04927 Cortisol synthesis and secretion
    112305718 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112305718 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    112305718 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    112305718 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    112305718 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112305718 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    112305718 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    112305718 (ATF2)
   05031 Amphetamine addiction
    112305718 (ATF2)
   05034 Alcoholism
    112305718 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112305718 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112305718 (ATF2)
   05161 Hepatitis B
    112305718 (ATF2)
   05163 Human cytomegalovirus infection
    112305718 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112305718 (ATF2)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    112305718 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 112305718
NCBI-ProteinID: XP_024417226
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPPSLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSAEPALSQIVMAPSSQAQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaactctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgaattggcaagtccatttgagaatgaattcaagaaagcctca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agcaaaattgaggagccatctgtcgtagaaacaactcaccaagatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaagtaccattggcacaaactgcacagccaaca
tcagctattgttcgcccaccatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacttcaagtactgtaatcacccag
gcaccatcctccaacaggccaatcgttcctgtaccaggtccatttcctcttctgttacat
cttcccaatggacaaactatgcctgtggctattcctgcatcaattacaagttctaatgtg
catgttccagccgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccaggg
attccaggtccttcgtctcctcaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctcctgtgaccaatggcgatacagtaaaaggtcatggtagt
ggactggttaggactcaatcagaggaatcccgaccacagtcattacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaaatacaagt
ggtcgtcgaagaagagcagctaatgaagatcctgatgaaaaaagaaggaagtttctggag
cgaaacagagcagcggcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggacaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttctcctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgcggataaggacgatagttcagaagac
ttgtcggtgccaagtagtccacatactgaagctatacagcatagttctgtcagcacatcc
aatggagtcagctccacctccaaggcagaagccgtggccacgtcagtcctcacccagatg
gcggaccagagtgcagagcctgccctctcacagattgttatggctccttcctcccaggca
cagccctcaggaagttga

KEGG   Desmodus rotundus (common vampire bat): 112306927
Entry
112306927         CDS       T05907                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112306927 (CREB5)
   04024 cAMP signaling pathway
    112306927 (CREB5)
   04022 cGMP-PKG signaling pathway
    112306927 (CREB5)
   04151 PI3K-Akt signaling pathway
    112306927 (CREB5)
   04152 AMPK signaling pathway
    112306927 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112306927 (CREB5)
   04922 Glucagon signaling pathway
    112306927 (CREB5)
   04915 Estrogen signaling pathway
    112306927 (CREB5)
   04926 Relaxin signaling pathway
    112306927 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    112306927 (CREB5)
   04918 Thyroid hormone synthesis
    112306927 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    112306927 (CREB5)
   04925 Aldosterone synthesis and secretion
    112306927 (CREB5)
   04927 Cortisol synthesis and secretion
    112306927 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112306927 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112306927 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    112306927 (CREB5)
   04728 Dopaminergic synapse
    112306927 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    112306927 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    112306927 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112306927 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    112306927 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112306927 (CREB5)
   05020 Prion disease
    112306927 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    112306927 (CREB5)
   05031 Amphetamine addiction
    112306927 (CREB5)
   05034 Alcoholism
    112306927 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112306927 (CREB5)
   04934 Cushing syndrome
    112306927 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112306927 (CREB5)
   05161 Hepatitis B
    112306927 (CREB5)
   05163 Human cytomegalovirus infection
    112306927 (CREB5)
   05165 Human papillomavirus infection
    112306927 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112306927 (CREB5)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    112306927 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 112306927
NCBI-ProteinID: XP_024418756
LinkDB
Position
Unknown
AA seq 508 aa
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFNELDCSLEHEFRKAQEEESSKRSISMHNAVGGAMAGPGAHQLGST
RMPNHDTGVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHIHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSNLLGMQGPTLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHAHPHQHQTLPAHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSAVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgatttatgaggagtccaagatgaatttggagcaggagaggccgtttgtctgcagcgcc
ccgggctgctcccagcgcttcccaacagaggaccatctgatgattcataggcacaagcat
gaaatgactttgaagtttccctcaataaaaacagacaatatgttatcagatcagaccccg
accccaacgagattcctgaagaactgcgaggaagtggggctcttcaatgagctggactgc
tccctggagcatgagttcaggaaggcgcaggaggaggagagcagcaagcggagtatctcg
atgcataatgcagttggcggggccatggcagggcccggagctcaccagcttggcagcacc
cggatgcccaaccacgacaccggcgttgtgattcagcaagccatgccgtcaccccagtcc
agctctgtcatcacacaagcaccttccaccaatcgccagatcgggcctgtcccaggctct
ctatcttctctgctacacatccacaacagacagagacagcccatgccagcctccatgccc
gggaccctgcctaacccgacaatgccgggatcttctgccgtcctgatgccaatggagaga
caaatgtcagtcaactccaacctcctgggaatgcaaggcccgactctcagcaatccctgt
gcttctcctcaagtccagcccatgcattcggaagccaaaatgaggctgaaggctgcgttg
actcaccaccccgccgccatgtcaaacgggaatatgaacaccatgggacacatgatggaa
atgatgggctcccggcaggaccagacgccgcaccaccacatgcacgcacacccgcatcag
caccagacactgccagcccaccacccctacccgcaccagcaccagcacccagcacaccat
ccccaccctcagccccatcaccagcagaaccacccacatcatcactcccactcccacctt
cacgcacacccagcacaccaccagacctcgccacacccacccctgcactccggcaaccaa
gcacaggtttcaccagcgacgcagcagatgcagcccacccagacgatacagccgccccaa
cccaccggggggcgccggcgaagggtggtggatgaggatccagatgagaggaggcggaaa
tttctggaacggaaccgggcagccgccacccgctgcagacagaagaggaaggtctgggtg
atgtcactggaaaagaaagctgaggaactcacccagacaaacatgcagcttcagaacgag
gtgtccatgttgaaaaacgaggttgcgcagctgaagcagttgttgctaacacacaaagac
tgcccgataacagccatgcagaaagagtcgcaaggatatctcagtccggagagtagccct
cctgcgagccccgtccccgcttgctctcagcagcaggtcatccagcataacaccatcact
acgtcctcggcggtcagcgaggtggtaggaagctctaccctcagccagctcaccactcac
agaacagacctgaatccgattctctaa

KEGG   Desmodus rotundus (common vampire bat): 112307981
Entry
112307981         CDS       T05907                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04380  Osteoclast differentiation
dro04612  Antigen processing and presentation
dro04668  TNF signaling pathway
dro04710  Circadian rhythm
dro04713  Circadian entrainment
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112307981 (CREB1)
   04024 cAMP signaling pathway
    112307981 (CREB1)
   04022 cGMP-PKG signaling pathway
    112307981 (CREB1)
   04151 PI3K-Akt signaling pathway
    112307981 (CREB1)
   04152 AMPK signaling pathway
    112307981 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    112307981 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    112307981 (CREB1)
   04922 Glucagon signaling pathway
    112307981 (CREB1)
   04915 Estrogen signaling pathway
    112307981 (CREB1)
   04926 Relaxin signaling pathway
    112307981 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    112307981 (CREB1)
   04918 Thyroid hormone synthesis
    112307981 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    112307981 (CREB1)
   04916 Melanogenesis
    112307981 (CREB1)
   04924 Renin secretion
    112307981 (CREB1)
   04925 Aldosterone synthesis and secretion
    112307981 (CREB1)
   04927 Cortisol synthesis and secretion
    112307981 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112307981 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112307981 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    112307981 (CREB1)
   04728 Dopaminergic synapse
    112307981 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112307981 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    112307981 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    112307981 (CREB1)
   04713 Circadian entrainment
    112307981 (CREB1)
   04714 Thermogenesis
    112307981 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112307981 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    112307981 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112307981 (CREB1)
   05020 Prion disease
    112307981 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    112307981 (CREB1)
   05031 Amphetamine addiction
    112307981 (CREB1)
   05034 Alcoholism
    112307981 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112307981 (CREB1)
   04934 Cushing syndrome
    112307981 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112307981 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112307981 (CREB1)
   05161 Hepatitis B
    112307981 (CREB1)
   05163 Human cytomegalovirus infection
    112307981 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112307981 (CREB1)
   05165 Human papillomavirus infection
    112307981 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112307981 (CREB1)
   03029 Mitochondrial biogenesis [BR:dro03029]
    112307981 (CREB1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112307981 (CREB1)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    112307981 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 112307981
NCBI-ProteinID: XP_024419932
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaacattagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaaagaagagaaattctttcaaggaggccttcttacaggaaaatcttgaatgat
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcgcctgccatcaccactgtaacggtgccaactccgatttaccaaacgagcagcgga
cagtacattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaactatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagatccgcacagcacccacaagc
accattgcccctggcgtggttatggcgtcctccccagcgcttcctacacagcctgctgaa
gaagccgcgcggaagagagaggtgcgcctcatgaagaatagggaagcagcacgagagtgt
cgcagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtacttgaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattag

KEGG   Desmodus rotundus (common vampire bat): 112312688
Entry
112312688         CDS       T05907                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112312688 (CREB3L3)
   04024 cAMP signaling pathway
    112312688 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    112312688 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    112312688 (CREB3L3)
   04152 AMPK signaling pathway
    112312688 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112312688 (CREB3L3)
   04922 Glucagon signaling pathway
    112312688 (CREB3L3)
   04915 Estrogen signaling pathway
    112312688 (CREB3L3)
   04926 Relaxin signaling pathway
    112312688 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    112312688 (CREB3L3)
   04918 Thyroid hormone synthesis
    112312688 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    112312688 (CREB3L3)
   04916 Melanogenesis
    112312688 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    112312688 (CREB3L3)
   04927 Cortisol synthesis and secretion
    112312688 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112312688 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112312688 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    112312688 (CREB3L3)
   04728 Dopaminergic synapse
    112312688 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    112312688 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    112312688 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112312688 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    112312688 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112312688 (CREB3L3)
   05020 Prion disease
    112312688 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    112312688 (CREB3L3)
   05031 Amphetamine addiction
    112312688 (CREB3L3)
   05034 Alcoholism
    112312688 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112312688 (CREB3L3)
   04934 Cushing syndrome
    112312688 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112312688 (CREB3L3)
   05161 Hepatitis B
    112312688 (CREB3L3)
   05163 Human cytomegalovirus infection
    112312688 (CREB3L3)
   05165 Human papillomavirus infection
    112312688 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112312688 (CREB3L3)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112312688 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136
Other DBs
NCBI-GeneID: 112312688
NCBI-ProteinID: XP_024425059
LinkDB
Position
Unknown
AA seq 463 aa
MNGDLAAGKMASSTCPMGPIDSLELLDLLFDRRDGILRHADLGEDWSHAGDQQVLPAPDS
DDFLNCILSSGDSVPSSPLWSPAASDSGISEDLPSDPQDTPPHNGPVTTPAGCHFSESGK
GLCPSYHPVPHSPTRSLRPVAQVLEASVAIDLEMWNTGLYPEKQTELADLPQHCNLTVKD
LLLSGSGGDLQQHHLAAPHLLRPGTGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEER
VLKKIRRKIRNKQSAQESRKKKKEYIDGLESRMSACTAQNQELQRKVLYLEKQNLSLLEQ
LKKLQAIVLQSTSKSAQAGTCIAVLLLSFALIVLPSISPFASNKAESPGDFTPVRVFSRT
LHNDAASRVAPDTMPSSKAPGPQPEADTPQEGSPEEGSPESPRAHWESQDMLALDNLTEK
LDKSTMVQGNWTEDLSRATLLDWASPEPALRPGHVGLEAGEEL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaatggagatttagcagctggaaagatggcttcctccacctgccccatgggccccatc
gacagcctggagctcctggatctcctgtttgatcggcgggatggaattctgagacatgca
gatctgggcgaggactggagccatgctggggaccagcaggtgctgccggccccggactct
gatgatttcctcaattgtatcttgagttctggagactcagtgcccagctctcctctctgg
tctcctgcagccagtgacagcggcatctctgaagatctgccctctgacccccaggatacc
cctccacacaacgggccggtcaccaccccggctggctgccatttctcggagtctggcaag
gggctctgcccgtcctaccatcctgtccctcacagccccaccaggtcccttcggccagtg
gcccaagtgctcgaggcctccgtggccatagacctggaaatgtggaacacgggcctctat
cccgagaagcagaccgagctggcggacttgccccagcattgcaacctcacggtgaaagac
ctcctcctctctggcagtggtggggacctgcaacagcatcacctggcagccccccacctg
ttaagacctgggactggacactgccaggagctggtgctgacagaagatgagaagaaactg
ttggccaaagaaggcatcacgctgcccacccagctgcccctcaccaagtatgaggagcga
gtgctgaaaaaaatccgccggaaaatccggaacaaacagtcggcccaagaaagccggaaa
aagaagaaggaatatattgatggcctggaaagtcggatgtcagcctgcactgcccagaac
caggagcttcagagaaaagtcttgtatctcgagaagcagaacctgtcccttctggagcag
ctgaagaaactccaggccattgtgctccaatccaccagcaagtcagcccaggcgggcacc
tgcatagcggtcctgctgctctctttcgccctcatcgtcctcccctccatcagccctttt
gcctccaacaaagctgagagtcccggagacttcacacctgtgcgagttttctccagaact
ttgcacaatgatgcagcttcccgtgtggcccctgataccatgccaagttccaaggctcca
ggaccccagcccgaggctgacacaccccaggaagggtctccagaggaagggtctccagaa
agccccagggctcactgggaatcccaggacatgctagctctggacaacttgacagagaag
ctcgacaagtcgaccatggtccagggcaattggacagaggacctgagccgggccaccctg
ctggactgggcctcgcctgagccagcactcaggccagggcatgtggggctggaggcgggg
gaagagctgtga

KEGG   Desmodus rotundus (common vampire bat): 112316383
Entry
112316383         CDS       T05907                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04714  Thermogenesis
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04931  Insulin resistance
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04962  Vasopressin-regulated water reabsorption
dro05016  Huntington disease
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112316383 (CREB3L4)
   04024 cAMP signaling pathway
    112316383 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    112316383 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    112316383 (CREB3L4)
   04152 AMPK signaling pathway
    112316383 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112316383 (CREB3L4)
   04922 Glucagon signaling pathway
    112316383 (CREB3L4)
   04915 Estrogen signaling pathway
    112316383 (CREB3L4)
   04926 Relaxin signaling pathway
    112316383 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    112316383 (CREB3L4)
   04918 Thyroid hormone synthesis
    112316383 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    112316383 (CREB3L4)
   04916 Melanogenesis
    112316383 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    112316383 (CREB3L4)
   04927 Cortisol synthesis and secretion
    112316383 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112316383 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112316383 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    112316383 (CREB3L4)
   04728 Dopaminergic synapse
    112316383 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    112316383 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    112316383 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112316383 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    112316383 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112316383 (CREB3L4)
   05020 Prion disease
    112316383 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    112316383 (CREB3L4)
   05031 Amphetamine addiction
    112316383 (CREB3L4)
   05034 Alcoholism
    112316383 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112316383 (CREB3L4)
   04934 Cushing syndrome
    112316383 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112316383 (CREB3L4)
   05161 Hepatitis B
    112316383 (CREB3L4)
   05163 Human cytomegalovirus infection
    112316383 (CREB3L4)
   05165 Human papillomavirus infection
    112316383 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112316383 (CREB3L4)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112316383 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 MscS_porin DUF4200 OppC_N EMP24_GP25L DUF1664 DUF2207 JMY
Other DBs
NCBI-GeneID: 112316383
NCBI-ProteinID: XP_024429013
LinkDB
Position
Unknown
AA seq 436 aa
MDFGTPDLLDFWLEPPDEVLTGSSLELGHHCPPPEVPVTMLQEQGLQGCESGGGHVCGLQ
ESEAEDFPKLFIDPNEVYCSEASPGSDSRISEDPGHPDSPPVPKAPSSPAFYEVVYEAEV
LEKMQEEAGPAVGFISIQLDQWSPPFMVPDACTVSELPLDAHACILPRAGTVNPVLPATL
LPCQTLFLTDEEKRLLRQEGISLSSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEY
IDGLESRVAACSAQNQELQKKVQELERHNISLVTQLRQLQMLITQTSNKAAQTSTCVLIL
LFSLALIILPSFSPFQGLPEAGSEDYQPHGVISRNILTHKDITENWETPEVESRLGGPPG
ARSANGSTKTLLEKMGVKTGPSGHTRTMPRADEMLLWPQGSESHQDAPDVYPESTYVRWH
LKYFYGISVILFLLWR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggatttcggaacccctgacctgctggacttctggctggaacccccagatgaagtctta
acaggatcctccctggagctgggacaccactgtccacctccagaggtcccagtgacgatg
ctacaagaacagggcttgcaaggctgcgagtctggtgggggccatgtctgtggccttcaa
gagagtgaagctgaagatttcccaaagcttttcattgatcccaatgaagtgtactgctca
gaagcgtctcctggcagtgacagtcgaatctctgaggaccctggtcatccagacagtccc
cctgtccccaaggcacccagttcccctgccttctatgaggttgtttatgaggcagaggtc
ctggagaagatgcaggaggaagctgggccagctgtagggttcatctccattcagctagat
cagtggagcccaccatttatggtgcctgatgcctgcacggtcagcgagctgccccttgat
gctcatgcctgcatcctgcccagggcaggcactgtaaacccagtgcttcctgctaccctg
ctgccctgtcaaaccttgttcctgacagatgaggagaagcgtcttctcaggcaggaaggg
atttccctgtcctctcacctgcccctcaccaaggcagaggaaagggttctcaagaaggtc
aggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaagagtac
atcgatggactagaaagcagggtggctgcctgttctgcacagaaccaggaactacagaaa
aaagtccaggagctggagagacacaacatctccttggtgactcagctccgccagctgcag
atgctcattactcaaacttccaacaaagctgcccagaccagcacttgtgttctgatcctt
cttttttctctggctctcatcatcctgcccagtttcagcccctttcaaggtctaccagaa
gctgggtccgaggattaccagcctcatggagttatttccagaaatatcctgacccacaag
gacataacagaaaattgggagaccccagaggtagaatccagattgggggggccacctggg
gctaggagtgcaaatggatcaacgaaaacactgctggagaagatgggagtgaagacaggc
cccagtgggcacaccagaactatgccgcgtgcagatgagatgcttctctggcctcaggga
tctgaatcacatcaagatgccccagatgtctaccctgagtccacctatgtgagatggcac
ctcaaatacttttatggtatatctgtgattttatttcttctttggagatag

KEGG   Desmodus rotundus (common vampire bat): 112321682
Entry
112321682         CDS       T05907                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04137  Mitophagy - animal
dro04141  Protein processing in endoplasmic reticulum
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04720  Long-term potentiation
dro04722  Neurotrophin signaling pathway
dro04725  Cholinergic synapse
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04918  Thyroid hormone synthesis
dro04922  Glucagon signaling pathway
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04932  Non-alcoholic fatty liver disease
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
dro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112321682 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112321682 (ATF4)
   04668 TNF signaling pathway
    112321682 (ATF4)
   04022 cGMP-PKG signaling pathway
    112321682 (ATF4)
   04151 PI3K-Akt signaling pathway
    112321682 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112321682 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    112321682 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112321682 (ATF4)
   04922 Glucagon signaling pathway
    112321682 (ATF4)
   04912 GnRH signaling pathway
    112321682 (ATF4)
   04915 Estrogen signaling pathway
    112321682 (ATF4)
   04926 Relaxin signaling pathway
    112321682 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    112321682 (ATF4)
   04918 Thyroid hormone synthesis
    112321682 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    112321682 (ATF4)
   04925 Aldosterone synthesis and secretion
    112321682 (ATF4)
   04927 Cortisol synthesis and secretion
    112321682 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112321682 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    112321682 (ATF4)
   04728 Dopaminergic synapse
    112321682 (ATF4)
   04720 Long-term potentiation
    112321682 (ATF4)
   04722 Neurotrophin signaling pathway
    112321682 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    112321682 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112321682 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    112321682 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112321682 (ATF4)
   05012 Parkinson disease
    112321682 (ATF4)
   05014 Amyotrophic lateral sclerosis
    112321682 (ATF4)
   05020 Prion disease
    112321682 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    112321682 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    112321682 (ATF4)
   05031 Amphetamine addiction
    112321682 (ATF4)
   05034 Alcoholism
    112321682 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112321682 (ATF4)
   04934 Cushing syndrome
    112321682 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112321682 (ATF4)
   05161 Hepatitis B
    112321682 (ATF4)
   05163 Human cytomegalovirus infection
    112321682 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112321682 (ATF4)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    112321682 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 V_ATPase_I Fez1 GAS Baculo_F ZapB
Other DBs
NCBI-GeneID: 112321682
NCBI-ProteinID: XP_024434925
LinkDB
Position
Unknown
AA seq 351 aa
MTEMSFLSSEVLVGDFVSPFDQSGLGAEESLGLLDDSPEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSASDNGKEDAFSGTDWMVEKMDLNEFDFDALLGLDDLEIMPDELWATLEDSC
DLLDPLNQEINKEPPQAVNPIGHLPESLPKTDQVAPFTLLQPCPLSPVALSSTLDHSFSL
ELGSEVDISEGDRKSDSAAYIIIIPQCIKEEEAASDSDSGICMSPESDQGSPQHSPSTSR
ASPNSLLSPDALCGTARPKPYDPPGEKVVAAKIKGEKLDKKLKKMQQNKTAATRYRQKKR
AEQEALTGECKELEKKNEVLKEKADSLAKEIQYLKDLIEEVRKARGKKRAP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgagatgagtttcctgagcagcgaggtgttggtgggggacttcgtgtcccccttc
gaccagtcgggcttgggggctgaagaaagcctaggtctcttagatgactccccggaggtg
gccaagcactttaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcctcagacaacggcaaggaggatgccttctcc
gggacagattggatggtggagaaaatggatctcaacgagtttgattttgatgccttgtta
ggtttagatgacctggaaatcatgccggatgagctttgggccacgttggaagactcgtgt
gatctccttgaccccctaaaccaggagattaataaggagcccccccaggcagtgaaccca
ataggccatcttccagaaagtttaccaaaaactgatcaggttgctccctttaccttactg
caaccttgtccgctttccccagtggccctgtcctccactctggatcattcctttagttta
gagctaggcagtgaagtcgatatctctgaaggagataggaagtcagactctgctgcttac
attatcataatcccccagtgcataaaggaggaggaagctgcctcagacagtgacagtggc
atctgtatgagcccagagtccgaccagggctccccgcagcacagtccctctacctccagg
gcatctccaaatagtttgctgtccccagatgccttgtgtggcactgcccgccccaaaccc
tatgaccctcctggagagaaggtggtggcagcaaaaataaagggtgaaaaactagataaa
aagctgaagaaaatgcagcagaacaagacggcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcacgggtgagtgtaaagagctagaaaagaaaaatgaggttctg
aaagagaaggcagattcgttggccaaggagatacagtatctgaaagatttgatagaagag
gtgcgcaaggcgaggggaaagaaaagggccccctag

DBGET integrated database retrieval system