KEGG   Desmodus rotundus (common vampire bat): 112300174
Entry
112300174         CDS       T05907                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00480  Glutathione metabolism
dro00980  Metabolism of xenobiotics by cytochrome P450
dro00982  Drug metabolism - cytochrome P450
dro00983  Drug metabolism - other enzymes
dro01100  Metabolic pathways
dro01524  Platinum drug resistance
dro05200  Pathways in cancer
dro05204  Chemical carcinogenesis
dro05225  Hepatocellular carcinoma
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112300174
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112300174
   00982 Drug metabolism - cytochrome P450
    112300174
   00983 Drug metabolism - other enzymes
    112300174
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112300174
   05204 Chemical carcinogenesis
    112300174
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112300174
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112300174
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112300174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dro02000]
    112300174
Enzymes [BR:dro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112300174
Transporters [BR:dro02000]
 Other transporters
  Pores ion channels [TC:1]
   112300174
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 112300174
NCBI-ProteinID: XP_024411129
LinkDB
Position
Unknown
AA seq 241 aa
MSGGSVKSLEKGSAPPGPVREGLIRVYSMRFCPFAERTRLVLAAKGIKHEVININLKNKP
EWFFEKNPFGLVPVLENSQGQLIYESAITCEYLDEVYPGKKLLPEDPYEKARQKMVFELF
SKVPSLIGSFIRSKNKEDCSGLKEELRKEFSKLEEVLTSKKTTFFGGNSLSMIDYLIWPW
FARLEALELNECVDHTPKLKLWVAAMRKDPSVSALLTDVKTFQGFLNLYLQNSLEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggagggtcagtcaagagcctggagaagggaagcgcgcccccagggcccgtccgg
gagggcctgatccgcgtctacagcatgcggttctgcccgttcgccgagaggacgcgccta
gtcctggcagccaagggaatcaagcatgaagttatcaacatcaacctgaaaaataagcct
gagtggttctttgagaagaatccctttggtctggtgccagttctggagaacagtcagggt
cagctgatctatgagtctgccatcacctgtgagtacctggatgaagtgtatccagggaag
aagctgttgccagaggacccctatgagaaagcacgccaaaagatggtctttgagttattt
tctaaggtaccatcgctgataggaagctttattagaagtaaaaataaggaagactgctct
ggcttgaaagaagaacttcgtaaagaattcagcaagcttgaggaggttctgaccagtaag
aagacaaccttctttggtggcaattcactttctatgattgattacctcatctggccctgg
tttgcacggctggaagcactggagttaaatgagtgtgtagaccacactccaaaacttaag
ctctgggtggcagccatgaggaaagatcccagtgtgtcagccctcctcactgatgtgaag
accttccaaggtttcttaaatctctacttgcagaacagcctggaggcctgtgactatggg
ctttga

DBGET integrated database retrieval system