KEGG   Desmodus rotundus (common vampire bat): 112300725
Entry
112300725         CDS       T05907                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04020  Calcium signaling pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04066  HIF-1 signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04072  Phospholipase D signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04380  Osteoclast differentiation
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04625  C-type lectin receptor signaling pathway
dro04650  Natural killer cell mediated cytotoxicity
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04750  Inflammatory mediator regulation of TRP channels
dro04919  Thyroid hormone signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05171  Coronavirus disease - COVID-19
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05223  Non-small cell lung cancer
dro05225  Hepatocellular carcinoma
Module
dro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112300725 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112300725 (PLCG2)
   04014 Ras signaling pathway
    112300725 (PLCG2)
   04370 VEGF signaling pathway
    112300725 (PLCG2)
   04064 NF-kappa B signaling pathway
    112300725 (PLCG2)
   04066 HIF-1 signaling pathway
    112300725 (PLCG2)
   04020 Calcium signaling pathway
    112300725 (PLCG2)
   04070 Phosphatidylinositol signaling system
    112300725 (PLCG2)
   04072 Phospholipase D signaling pathway
    112300725 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112300725 (PLCG2)
   04613 Neutrophil extracellular trap formation
    112300725 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    112300725 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    112300725 (PLCG2)
   04662 B cell receptor signaling pathway
    112300725 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    112300725 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    112300725 (PLCG2)
   04670 Leukocyte transendothelial migration
    112300725 (PLCG2)
   04062 Chemokine signaling pathway
    112300725 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    112300725 (PLCG2)
   04919 Thyroid hormone signaling pathway
    112300725 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112300725 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112300725 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    112300725 (PLCG2)
   04380 Osteoclast differentiation
    112300725 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112300725 (PLCG2)
   05206 MicroRNAs in cancer
    112300725 (PLCG2)
   05205 Proteoglycans in cancer
    112300725 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112300725 (PLCG2)
   05214 Glioma
    112300725 (PLCG2)
   05223 Non-small cell lung cancer
    112300725 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112300725 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112300725 (PLCG2)
   05171 Coronavirus disease - COVID-19
    112300725 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112300725 (PLCG2)
   05169 Epstein-Barr virus infection
    112300725 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112300725 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112300725 (PLCG2)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112300725 (PLCG2)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112300725 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112300725 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH PH_12 SH3_2 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 112300725
NCBI-ProteinID: XP_024411812
LinkDB
Position
Unknown
AA seq 1265 aa
MTTMVNVDGLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKCSKDFERAKAVRQKEDCCFTILYGTQFTLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFLEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNRVRKRMTKFIDDTMRETAEPFLFVDEFLMYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVVLSIEEHCGVEQQRYMARV
FKEVFGDMLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDTPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCSETGGKDGTFLVRESERFPNDYTLSFWRSGRVQHCRIRSTMEDGVMKYY
LTDNLMFPSIYALIQYYRGTHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGSDSYAITFRAKGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
KKHALYRKMKLRYPVTPDLLERYSMERDINSLYDVSRMYVDPSEISPSMPQRTVKALYDY
KAKQSDELSFYRGALIHNVSKEPGGWWKGDYGTKIQQYFPSNYVEDISSVDVEDLEKQII
EDNPLGSLCRGILDLNAYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIRQITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNQKALTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNQALFSLNGRTGYVLQPESMRTDKYDPMPPESQRKIQMTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALIKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccaccatggtcaatgtggatggccttccggagtatgagaagagtcagatcaagaga
gccctggagctgggcacagtgatgaccgtgttcagcttccgcaagtccaccccggagcgc
aggactgtgcaggtgatcatggagacgcggcaggtggcctggagtaagacagccgacaag
atcgaaggctttttggatatcatggaaataaaggaaatccgcccggggaagtgctccaag
gattttgagcgtgcaaaagcagtccgccagaaggaagactgctgcttcaccatcctgtac
ggcacccagttcaccctcagcacactcagtttagcagctgactccaaggaagatgcaacc
aagtggctctctggcttgaaaatcttacaccaagaagcaatgagtgcatccacacccacc
attattgagagttggctgagaaagcagatttattcagtggaccaaaccagaagaaacagc
atcagcctccgagagctgaagaccatcttgcccctggtcaacttcaaagtgagcagtgcc
aagttcctcaaggataagtttttggaaataggcgcgcacaaagacgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaagtcgattctcgacgaa
ttcaaaaaagactcctccgtgttcatcttggggaacactgaccggccggatgcctccgct
gttcacctgcacgatttccagcggtttctcttacatgagcagcaggagctctgggctcag
gatctgaacagagtccgcaagaggatgactaagtttatcgacgacacgatgagggaaact
gcggagcccttcctatttgttgatgagttcctcatgtacctgttttcacgggagaacagc
atttgggatgagaagtatgacgtggtggacatgcaggacatgaacaaccccttgtcccat
tactggatctcctcatcacataacacgtacctcacaggtgaccagctgcggagtgagtcg
tccacggaggcatacatccgctgtctgcgcatgggctgtcgctgcattgagttggactgc
tgggatgggcctgacgggaagcccatcatctaccacggctggacacggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcgagcttcccc
gtggtcctgtccatcgaggagcactgtggcgtggaacagcagcgctacatggccagagtg
tttaaggaggtgtttggcgacatgctgctgatgaagcccacggaggccagtgccgaccag
ctgccctcacccagccagctgcgggaaaagatcatcatcaagcacaagaagctgggcccc
cgaggcgacgtagatgtcaacgtggaggacaagaaagatgagcacaagcaacagggcgaa
ctgtacatgtgggactccatcgaccagaaatggactcggcactactgcgccatcgccgat
gccaagctgtccttcagcgatgacattgaacagaccatggaagaggaagtgccccaggat
acgcctcccaccgagctgcattttggagagaagtggtttcataagaaggtggagaagagg
acgagtgctgagaagctgctgcaggaatactgctctgagacggggggcaaggacggaacc
ttcttggtgcgggagagcgagaggttccccaatgactacaccctgtccttctggcggtca
ggccgggtccagcactgccggatccgctccaccatggaggacggggtcatgaagtattac
ctgactgacaacctcatgttccccagcatctacgccctcatccagtactaccgcgggacg
cacctgcgctgcgccgagttcgagcttcggctcactgaccctgtgcccaaccccaacccc
catgagtcaaaaccgtggtactatgacgggctgagccgtggagaagcggaggacatgctg
atgagagttccccgggacggcgccttcctcatccggaagcgggaaggcagcgactcctac
gccatcaccttcagggccaagggcaaggtgaagcactgtcgcatcaaccgggacggccgg
cacttcgtgctggggacctccgcctacttcgagagtctggtggagctcgtcagttactac
aagaagcatgcgctgtaccgaaagatgaagctgcgctaccccgtgactcccgatctcctg
gagcgctacagtatggaaagagacataaactccctgtatgatgtcagcagaatgtatgtg
gatcccagtgagatcagtccttctatgcctcagagaactgtgaaagctctgtatgactac
aaagccaagcagagtgatgagctgagcttctaccgtggcgccctcattcacaacgtctcc
aaggagcctgggggctggtggaaaggagactatggaaccaaaatccagcagtacttcccg
tccaattacgttgaggacatttcatcggttgatgtggaggatctggagaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaatgcctataatgtt
gtgaaagccccacaggggaaaaaccagaagcctttcgtctttatcctggagcccaagaag
cagggggaccctccggtggagtttgccacagacagggtggaagagctctttgaatggttt
cagagcatccggcagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcgatcgccatcgagctctcggacctggtcgtgtactgcaaaccaacc
agcaagaccaaagacaacttagaaaatcccgacttccgagaaatccgttcctttgtggag
acgaaggctgacagcgtcgtcaggcagaaacccatcgatctcctgaagtacaatcagaag
gccctgacccgcgtttacccgaagggacagagggtggattcctccaactacgatcccttc
cgtctctggctgtgtggctcccaaatggtggcactcaattttcagactgcggacaagtac
atgcagatgaatcaggccttgttctcactcaatgggaggaccggctacgtcctacagccc
gagagcatgaggacagataagtacgaccccatgccacccgagtcccagaggaagattcag
atgaccttgacggtcaaggttctcggggctcgccatcttcccaagcctggacggagcatt
gcatgtccctttgtggaggtggaaatatgtggagctgaatatgacaacaacaagtttaag
acgacggttgtgaatgacaatggcctaagccctgtttgggctccaacacaggagaaggtg
acatttgaaatttatgatccaaacctcgcgtttctgcgctttgtggtgtatgaggaagat
atgttcagcgaccccaactttctcgctcatgctacataccccattaaaggaatcaaatca
ggatttagatctgttcctctgaagaatgggtacagcgaagacattgagctggcctccctc
ctggttttctgtgagatgcggccagtgctggagagcgaagaggaactgtactcctcctgt
cgccagctgcggaggcggcaagaggagctgaacaaccagctctttctatatgacacgcac
cagaacctgcgcaatgccaaccgggatgccctcattaaagaattcaatgtcaacgagaac
cagctgcagctgtaccaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Desmodus rotundus (common vampire bat): 112303845
Entry
112303845         CDS       T05907                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04066  HIF-1 signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04072  Phospholipase D signaling pathway
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04613  Neutrophil extracellular trap formation
dro04650  Natural killer cell mediated cytotoxicity
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro04666  Fc gamma R-mediated phagocytosis
dro04670  Leukocyte transendothelial migration
dro04722  Neurotrophin signaling pathway
dro04750  Inflammatory mediator regulation of TRP channels
dro04919  Thyroid hormone signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04935  Growth hormone synthesis, secretion and action
dro05012  Parkinson disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05135  Yersinia infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05170  Human immunodeficiency virus 1 infection
dro05171  Coronavirus disease - COVID-19
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05223  Non-small cell lung cancer
dro05225  Hepatocellular carcinoma
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
dro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112303845 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112303845 (PLCG1)
   04014 Ras signaling pathway
    112303845 (PLCG1)
   04015 Rap1 signaling pathway
    112303845 (PLCG1)
   04370 VEGF signaling pathway
    112303845 (PLCG1)
   04064 NF-kappa B signaling pathway
    112303845 (PLCG1)
   04066 HIF-1 signaling pathway
    112303845 (PLCG1)
   04020 Calcium signaling pathway
    112303845 (PLCG1)
   04070 Phosphatidylinositol signaling system
    112303845 (PLCG1)
   04072 Phospholipase D signaling pathway
    112303845 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112303845 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    112303845 (PLCG1)
   04660 T cell receptor signaling pathway
    112303845 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    112303845 (PLCG1)
   04659 Th17 cell differentiation
    112303845 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    112303845 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    112303845 (PLCG1)
   04670 Leukocyte transendothelial migration
    112303845 (PLCG1)
   04062 Chemokine signaling pathway
    112303845 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    112303845 (PLCG1)
   04919 Thyroid hormone signaling pathway
    112303845 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112303845 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112303845 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    112303845 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303845 (PLCG1)
   05206 MicroRNAs in cancer
    112303845 (PLCG1)
   05205 Proteoglycans in cancer
    112303845 (PLCG1)
   05231 Choline metabolism in cancer
    112303845 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112303845 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112303845 (PLCG1)
   05214 Glioma
    112303845 (PLCG1)
   05223 Non-small cell lung cancer
    112303845 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112303845 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    112303845 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112303845 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112303845 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112303845 (PLCG1)
   05171 Coronavirus disease - COVID-19
    112303845 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112303845 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112303845 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112303845 (PLCG1)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112303845 (PLCG1)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112303845 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112303845 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 112303845
NCBI-ProteinID: XP_024415169
LinkDB
Position
Unknown
AA seq 1256 aa
MTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQ
EDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLTEDTLQAATPLQIE
RWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFA
QLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRFQVQ
EFMLDFLQDPLREIEEPYFSLDEFVTFLFSKENSVWNAKLDAVCPDAMNNPLSHYWISSS
HNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVL
HTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQ
LKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTS
SKIYYSEETSNDQGNEDEEEPKEASGSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCI
ETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYD
LITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
KRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRY
PINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQRDDELTFTK
SAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMVSPAALEPEREHLDENSPLGDLLRG
VLDVPACQIAIRPEGKNNRLFVFSISMASVAQWSLDVAADSQEELQDWVKKIREVAQTAD
ARLTEGKMMERRKKIALELSELVVYCRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNK
AKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALF
MTGGHCGYVRQPGTMRDEAFDPFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEI
EVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLA
QATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKIDVFPAKENGDLSPFGGTSLRERGSD
ASGQLFHGRAREGSFEARYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3771 nt   +upstreamnt  +downstreamnt
atgactttgttctactccaagaagtcgcagcggccggagcggaagaccttccaggtcaag
ctggagactcggcagatcacgtggagccgcggcgccgacaagatcgagggggccattgac
attcgagaaatcaaggagatccgcccagggaagacctcacgggactttgaccgctaccaa
gaggaccctgctttccgaccagaccagtcacactgctttgtcatcctgtatgggatggaa
ttccgcctgaagaccctgagcctgcaagctacgtctgaggatgaagtgaacatgtggatc
aagggcttgacgtggctgacagaggacacactgcaggcagccacacccctgcagatcgag
aggtggctgcggaagcagttctactcagtggatcggaaccgggaggaccgcatctcagcc
aaggacttgaagaatatgctgtcccaggtcaactaccgggtccccaacatgcgcttcctt
cgagagcggctgacggacctggagcagcgcagcagcgacatcacctacgggcagttcgct
cagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttcttggaa
gccagcgccttgagggcaggggaacggccagagctttgccgagtgtcccttcctgagttc
caacagttcctcctcgagtaccagggggagctgtgggctgttgaccggttccaggtacag
gagttcatgcttgacttcctccaagaccccttgcgagagattgaggagccatacttctct
ctggatgagttcgtcaccttcctgttctccaaagagaacagcgtgtggaacgcgaagctg
gatgccgtgtgcccggacgccatgaacaaccctctctcccactactggatctcctcctcg
cacaacacgtacctgaccggggaccagttctccagcgagtcctccctggaagcctatgcc
cgctgcctgcggatgggctgtcgctgcattgaactggactgctgggacggccctgacggg
atgccagtcatttaccatggacacactctcaccaccaagatcaagttttcagacgttctg
cacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcctgtccattgag
gaccactgcagcattgcccagcagaggaacatggcccagtacttcaagaaggtcctcggg
gacacactcctcaccaagcccgtggacatcgccgccgacgggctcccttcgcccaaccag
ctcaagaggaagatccttatcaagcacaagaagctggccgagggcagcgcctatgaggag
gtgcccacatccgtgatgtactccgagaacgacatcagcaattccatcaagaacggcatc
ctctacctggaggaccccgtgaaccacgagtggtacccgcactacttcgtcctgaccagc
agcaagatctactactcagaggagaccagcaatgaccagggcaacgaggatgaggaagag
cccaaggaggccagtggcagcacagagctacactccaacgagaagtggttccacgggaag
ctcggggcaggacgggatgggcggcacatcgccgagcgcctgctgaccgagtactgcatt
gaaactggagcccccgacggctccttcctcgtgcgcgagagcgagacctttgtgggcgac
tacaccctctctttctggcggaacggcaaagtccaacactgccggatccactcccggcag
gatgccggcacccctaagttcttcttgacagacaaccttgtctttgactccctctatgac
ctcatcacacactaccagcaggtgcccctgcgctgcaacgagtttgagatgcgcctctca
gagcccgtcccacagaccaatgcccatgagagcaaagagtggtaccacgcaagcctgacc
agagcgcaggccgaacacatgctgatgcgtgtcccccgtgatggggccttcctggtgcgg
aaacggaatgagcccaactcctatgccatctccttccgggctgaagggaagatcaagcat
tgccgtgtgcagcaggagggccagacagtgatgttgggcaactcggagttcgacagccta
gtcgacctcatcagctactacgagaaacatccactgtaccgtaagatgaagctgcgctat
cccatcaacgaggaggcactggagaagatcggcacagctgagcctgactatggggccttg
tatgagggacgcaaccctggcttttatgtagaggcaaaccctatgccgacttttaagtgt
gcggtcaaagccctcttcgactacaaggcccagagagatgacgagctgacgttcaccaag
agcgccatcatccagaatgtggagaagcaggatggaggctggtggcggggagactatggt
gggaagaagcagctctggttcccgtccaactacgtggaggagatggtcagccctgcagcc
ctggagcctgagagggagcacctggatgagaacagccccctgggggacttgctgcggggg
gtcttggatgtgccagcgtgtcagattgccatccgtcccgagggcaagaacaaccggctc
ttcgtcttctccatcagtatggcatcggtggcgcagtggtccctggatgtggctgccgac
tcacaggaggagctgcaggactgggtgaaaaagatccgtgaagtggcccagactgcggac
gccaggctcactgaggggaagatgatggagcggaggaagaagatcgccctggagctctcc
gagctcgtcgtctactgccggcctgtccccttcgatgaagacaagattggaacagagcgc
gcctgctaccgggacatgtcgtccttcccggaaaccaaggctgagaagtatgtgaacaag
gccaaaggcaagaagttcctccagtacaaccgactgcaactctcccgcatctaccccaag
ggccagcggctggactcctccaattacgaccccttgcccatgtggatctgtggcagtcag
ctggtggctctcaacttccagaccccagacaaacctatgcagatgaaccaggcccttttc
atgaccggcgggcactgtggctatgtgcggcagcccggcaccatgcgggacgaggccttc
gaccccttcgacaagagcagccttcgcgggctggagccatgcgccatctgcatcgaggtg
ctaggtgcccggcatctgccaaagaatggccgaggcattgtgtgtccctttgtggagatc
gaggtggccggagctgagtacgacagcaccaagcagaagacagagtttgtggtggacaat
ggcctgaatcccgtgtggcccgccaagccattccacttccagatcagtaaccctgaattc
gctttcctgcgctttgtggtatatgaggaagacatgtttagtgaccagaacttcctggct
caggctactttcccggtgaaaggcctgaagacagggtacagagcggtgcctttgaagaac
aactacagtgaagacctggagctggcttccctgttggtcaagattgacgtcttccctgcc
aaggagaatggtgacctcagtccctttggtggtacatccctgcgggaacggggctctgat
gcctcaggtcagctgtttcatggccgggcccgggaaggctcctttgaagcacgctaccag
cagccatttgaggactttcgcatctcccaggagcatcttgcagaccattttgacagccgg
gaacgaagggccccacgaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system