KEGG   Desmodus rotundus (common vampire bat): 112301080
Entry
112301080         CDS       T05907                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00230  Purine metabolism
dro01100  Metabolic pathways
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112301080 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112301080 (FHIT)
   05223 Non-small cell lung cancer
    112301080 (FHIT)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     112301080 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 112301080
NCBI-ProteinID: XP_024412154
LinkDB
Position
Unknown
AA seq 136 aa
MSRVCIYYQKQAKYSLTDFTADVLVCPLRPVERFRDLRPDEVADLFQATQKVGTVVEKHF
QGTSLTFSMQDGPEAGQTVKHVHIHVLPRKAGDFHRNDSIYDELQKHDKEEEDSPTLWRS
EEEMAAEAAALRAYFQ
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtctcgtgtgtgcatatactaccaaaagcaagcaaagtattccttaacagacttcact
gcagatgtcctcgtgtgtccccttcggccagtggagcgcttccgagatctgcgtcccgat
gaagtggccgatttgtttcaggcgacccagaaagttggcacggtggtggaaaagcatttc
caggggacttctcttaccttttctatgcaggatggccccgaagctggacagactgtgaag
catgttcacatccacgttcttcccaggaaggctggagactttcacaggaatgacagcatc
tatgatgagctccagaaacatgacaaagaggaggaggactccccaaccttgtggagatcg
gaggaggaaatggcagcagaagccgctgcactgcgggcctactttcagtga

DBGET integrated database retrieval system