KEGG   Desmodus rotundus (common vampire bat): 112301523Help
Entry
112301523         CDS       T05907                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04020  Calcium signaling pathway
dro04024  cAMP signaling pathway
dro04062  Chemokine signaling pathway
dro04114  Oocyte meiosis
dro04140  Autophagy - animal
dro04211  Longevity regulating pathway
dro04213  Longevity regulating pathway - multiple species
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04310  Wnt signaling pathway
dro04340  Hedgehog signaling pathway
dro04371  Apelin signaling pathway
dro04530  Tight junction
dro04540  Gap junction
dro04611  Platelet activation
dro04713  Circadian entrainment
dro04714  Thermogenesis
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04727  GABAergic synapse
dro04728  Dopaminergic synapse
dro04740  Olfactory transduction
dro04742  Taste transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04910  Insulin signaling pathway
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04913  Ovarian steroidogenesis
dro04914  Progesterone-mediated oocyte maturation
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04923  Regulation of lipolysis in adipocytes
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04962  Vasopressin-regulated water reabsorption
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04976  Bile secretion
dro05012  Parkinson disease
dro05020  Prion diseases
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05032  Morphine addiction
dro05146  Amoebiasis
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112301523 (PRKACA)
   04010 MAPK signaling pathway
    112301523 (PRKACA)
   04310 Wnt signaling pathway
    112301523 (PRKACA)
   04340 Hedgehog signaling pathway
    112301523 (PRKACA)
   04371 Apelin signaling pathway
    112301523 (PRKACA)
   04020 Calcium signaling pathway
    112301523 (PRKACA)
   04024 cAMP signaling pathway
    112301523 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112301523 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112301523 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112301523 (PRKACA)
   04540 Gap junction
    112301523 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112301523 (PRKACA)
   04062 Chemokine signaling pathway
    112301523 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    112301523 (PRKACA)
   04910 Insulin signaling pathway
    112301523 (PRKACA)
   04922 Glucagon signaling pathway
    112301523 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    112301523 (PRKACA)
   04912 GnRH signaling pathway
    112301523 (PRKACA)
   04913 Ovarian steroidogenesis
    112301523 (PRKACA)
   04915 Estrogen signaling pathway
    112301523 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    112301523 (PRKACA)
   04921 Oxytocin signaling pathway
    112301523 (PRKACA)
   04926 Relaxin signaling pathway
    112301523 (PRKACA)
   04918 Thyroid hormone synthesis
    112301523 (PRKACA)
   04919 Thyroid hormone signaling pathway
    112301523 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    112301523 (PRKACA)
   04916 Melanogenesis
    112301523 (PRKACA)
   04924 Renin secretion
    112301523 (PRKACA)
   04925 Aldosterone synthesis and secretion
    112301523 (PRKACA)
   04927 Cortisol synthesis and secretion
    112301523 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112301523 (PRKACA)
   04270 Vascular smooth muscle contraction
    112301523 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    112301523 (PRKACA)
   04971 Gastric acid secretion
    112301523 (PRKACA)
   04976 Bile secretion
    112301523 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112301523 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112301523 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    112301523 (PRKACA)
   04727 GABAergic synapse
    112301523 (PRKACA)
   04725 Cholinergic synapse
    112301523 (PRKACA)
   04728 Dopaminergic synapse
    112301523 (PRKACA)
   04726 Serotonergic synapse
    112301523 (PRKACA)
   04720 Long-term potentiation
    112301523 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    112301523 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    112301523 (PRKACA)
   04742 Taste transduction
    112301523 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    112301523 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    112301523 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    112301523 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112301523 (PRKACA)
   04714 Thermogenesis
    112301523 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112301523 (PRKACA)
   05205 Proteoglycans in cancer
    112301523 (PRKACA)
   05203 Viral carcinogenesis
    112301523 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112301523 (PRKACA)
   05020 Prion diseases
    112301523 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    112301523 (PRKACA)
   05031 Amphetamine addiction
    112301523 (PRKACA)
   05032 Morphine addiction
    112301523 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    112301523 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112301523 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112301523 (PRKACA)
   05163 Human cytomegalovirus infection
    112301523 (PRKACA)
   05165 Human papillomavirus infection
    112301523 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112301523 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112301523 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112301523 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dro03019]
    112301523 (PRKACA)
   03036 Chromosome and associated proteins [BR:dro03036]
    112301523 (PRKACA)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112301523 (PRKACA)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: AGC group
  PKA family
   112301523 (PRKACA)
Messenger RNA biogenesis [BR:dro03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112301523 (PRKACA)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112301523 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 112301523
NCBI-ProteinID: XP_024412777
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagtgagcaggagagtgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcagtttgaacgaatcaagaccctcggcacaggctcctttgggcgggtgatgcta
gtgaaacacaaggagactgggaaccacttcgccatgaagatcctggacaaacagaaggtg
gtaaagctgaaacagatcgagcacaccttgaatgagaagcgcatcctacaggctgtcaac
tttccgttccttgtcagacttgagttctccttcaaggacaactcaaatttatacatggtc
atggagtatgtgcctggtggggaaatgttctcacacctaagacggatcggaaggttcagt
gagccccatgcccgcttctatgccgcccagattgtcctgaccttcgagtacctgcactcg
ctcgatctcatctaccgggacctgaagccggagaaccttctcatagaccagcagggctat
attcaggtgacagactttggttttgccaagcgcgtgaagggccgcacctggaccttgtgt
gggacccccgagtacctggcccccgagatcatcctgagcaaaggatacaacaaggccgtg
gactggtgggcactgggggttctcatctatgagatggcagccggctacccacccttcttt
gctgaccagcccattcagatctacgagaagattgtttctgggaaggtgcggttcccgtcc
cacttcagctctgacctaaaggatctgctgcggaacctcctgcaggtggatcttaccaag
cgcttcgggaacctcaagaatggggtcaatgacatcaagaaccacaaatggtttgccacg
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacaagtaactttgacgactatgaagaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system