KEGG   Desmodus rotundus (common vampire bat): 112301616
Entry
112301616         CDS       T05907                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04060  Cytokine-cytokine receptor interaction
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04630  JAK-STAT signaling pathway
dro04640  Hematopoietic cell lineage
dro04664  Fc epsilon RI signaling pathway
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05221  Acute myeloid leukemia
dro05310  Asthma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112301616 (IL3)
   04151 PI3K-Akt signaling pathway
    112301616 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112301616 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112301616 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112301616 (IL3)
   04664 Fc epsilon RI signaling pathway
    112301616 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112301616 (IL3)
   05202 Transcriptional misregulation in cancer
    112301616 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    112301616 (IL3)
  09163 Immune disease
   05310 Asthma
    112301616 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dro04052]
    112301616 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112301616 (IL3)
Cytokines and growth factors [BR:dro04052]
 Cytokines
  Interleukins
   112301616 (IL3)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Haparin
  Cytokines
   112301616 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 112301616
NCBI-ProteinID: XP_024412870
LinkDB
Position
Unknown
AA seq 149 aa
MSSLPVLALLLLLLAHRTPPAQGQPLPTTYITLIKEMRGLLSQPPVLSKGDLELDDKFIL
RNKTFLKTNLEEFLNATKNFKDRAERIKKILTQFQTVVPTAPSVQFQTVVPTAPSVEDSI
SIEENDWDDFRRKLKEYLDSLLKFVTAKI
NT seq 450 nt   +upstreamnt  +downstreamnt
atgagcagcctccccgtcctggcccttctcctgctcctgctcgcacaccgcacccctccg
gcacaggggcagcccttaccgactacctacatcaccctgatcaaggaaatgaggggcctc
ctcagccagccacctgtgctttcaaaaggtgacttggaattagatgacaaattcatcctg
cggaataaaacctttctgaaaacaaacctggaggaattcctgaatgctaccaagaatttc
aaagacagggcagagagaatcaagaaaatccttacgcaattccagacggttgtgcccacc
gccccttccgtgcaattccagacggttgtgcccaccgccccttccgtggaagactcaatc
tctatcgaagagaatgactgggacgatttcaggaggaagttgaaggaatatctggattcc
cttctgaagtttgtcactgccaaaatttga

DBGET integrated database retrieval system