KEGG   Desmodus rotundus (common vampire bat): 112302074
Entry
112302074         CDS       T05907                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04630  JAK-STAT signaling pathway
dro05162  Measles
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112302074 (CCND3)
   04390 Hippo signaling pathway
    112302074 (CCND3)
   04630 JAK-STAT signaling pathway
    112302074 (CCND3)
   04151 PI3K-Akt signaling pathway
    112302074 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112302074 (CCND3)
   04115 p53 signaling pathway
    112302074 (CCND3)
   04218 Cellular senescence
    112302074 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112302074 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112302074 (CCND3)
   05203 Viral carcinogenesis
    112302074 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302074 (CCND3)
   05164 Influenza A
    112302074 (CCND3)
   05162 Measles
    112302074 (CCND3)
   05169 Epstein-Barr virus infection
    112302074 (CCND3)
   05165 Human papillomavirus infection
    112302074 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112302074
NCBI-ProteinID: XP_024413385
LinkDB
Position
Unknown
AA seq 292 aa
MELLCCEGTRHAPRAGPDPRLWGDQRVLQSLLRLEERYLPGTSYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTPKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQMRDWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSLSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREAAQTSPSPAPKAPRGSGSQGPSQTSTPTEVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgagggcacccggcacgcgccccgggccgggccggacccgcgg
ctgtggggggaccagcgtgtcctgcagagcctgctccgcctggaggagcgctacctgccc
ggcacctcttacttccagtgcgtgcagagggagatcaagccccacatgcggaagatgctg
gcgtactggatgctggaggtgtgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcctgtgtcccgacccccaaggcgcagttgcag
ctcctgggggcagtctgcatgctgctagcctccaagctgcgcgagactacaccactgacc
atcgagaaattgtgcatctacaccgaccacgctgtgtctccccgccagatgcgggactgg
gaggtgctggtcctggggaagctcaagtgggacctggctgccgtgattgcccatgatttc
ctggccctgattctgcaccggctctctctgcccagtgaccgacaggccttggtcaagaag
catgctcagacctttttggccctctgtgccacagattacacctttgccatgtacccgccg
tccatgatcgccaccggcagcatcggggctgcagtgcaaggcctgggtgcctgttcctta
tccggagatgagctcacggagctgctggcggggatcacaggcactgaagtggactgcctg
cgggcctgtcaggagcagattgaagctgcactcagggagagcctcagggaagccgcccag
acctcccccagcccagcacccaaagcccctaggggctctggcagccaggggcccagccag
accagcactcccacagaagtcacagccatccatctgtag

KEGG   Desmodus rotundus (common vampire bat): 112312821
Entry
112312821         CDS       T05907                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04340  Hedgehog signaling pathway
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04630  JAK-STAT signaling pathway
dro04917  Prolactin signaling pathway
dro05162  Measles
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112312821 (CCND2)
   04340 Hedgehog signaling pathway
    112312821 (CCND2)
   04390 Hippo signaling pathway
    112312821 (CCND2)
   04630 JAK-STAT signaling pathway
    112312821 (CCND2)
   04068 FoxO signaling pathway
    112312821 (CCND2)
   04151 PI3K-Akt signaling pathway
    112312821 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112312821 (CCND2)
   04115 p53 signaling pathway
    112312821 (CCND2)
   04218 Cellular senescence
    112312821 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112312821 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    112312821 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312821 (CCND2)
   05202 Transcriptional misregulation in cancer
    112312821 (CCND2)
   05206 MicroRNAs in cancer
    112312821 (CCND2)
   05203 Viral carcinogenesis
    112312821 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112312821 (CCND2)
   05162 Measles
    112312821 (CCND2)
   05169 Epstein-Barr virus infection
    112312821 (CCND2)
   05165 Human papillomavirus infection
    112312821 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112312821
NCBI-ProteinID: XP_024425191
LinkDB
Position
Unknown
AA seq 289 aa
MELLCCEMDRVRRAVPDGNLLHDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEPILRRLPQPSEKLPLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTGDALVELLAKITNTDV
DCLKACQEQIEVVLLSNLQQFRQEQGDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgagatggaccgtgtccgcagggccgtgcccgacggcaacctg
ctccacgacgaccgcgttttgcagaacttgctcaccatcgaggagcgctaccttccccag
tgctcctatttcaaatgcgtgcagaaggacatccagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgtgaggaggaggtcttccctttggcc
atgaattacctggaccgcttcttggctggggtcccgactcctaagacccaccttcagctc
ctgggtgctgtctgcatgttcctggcctccaagctcaaggagaccatccccctgacggca
gagaagttgtgcatttacaccgacaactccatcaagcctcaggaactgctggagtgggag
ctggtggtgctggggaaattgaagtggaacctggcggcagtcactcctcacgacttcatc
gagcccatcctgcgcaggctgccccagcccagtgagaagctgcccctgatccgcaagcat
gcacagaccttcattgctctgtgtgccaccgatttcaagttcgccatgtacccgccatcg
atgattgcgactggaagtgtgggcgctgccatctgtgggctgcagcaggatgaggaagtg
agctcgctcactggcgatgccctggtggagctgctggccaagatcaccaacaccgacgtg
gattgcctcaaagcctgccaggagcagattgaggtggtgctgctcagcaacctgcagcag
ttccgtcaggagcagggggatggatccaagtcggaggatgaactggaccaagccagcacc
cctacagatgtgcgggatattgacctgtga

KEGG   Desmodus rotundus (common vampire bat): 112317273
Entry
112317273         CDS       T05907                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04152  AMPK signaling pathway
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04340  Hedgehog signaling pathway
dro04371  Apelin signaling pathway
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04530  Tight junction
dro04630  JAK-STAT signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112317273 (CCND1)
   04340 Hedgehog signaling pathway
    112317273 (CCND1)
   04390 Hippo signaling pathway
    112317273 (CCND1)
   04371 Apelin signaling pathway
    112317273 (CCND1)
   04630 JAK-STAT signaling pathway
    112317273 (CCND1)
   04068 FoxO signaling pathway
    112317273 (CCND1)
   04151 PI3K-Akt signaling pathway
    112317273 (CCND1)
   04152 AMPK signaling pathway
    112317273 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112317273 (CCND1)
   04115 p53 signaling pathway
    112317273 (CCND1)
   04218 Cellular senescence
    112317273 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112317273 (CCND1)
   04530 Tight junction
    112317273 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    112317273 (CCND1)
   04921 Oxytocin signaling pathway
    112317273 (CCND1)
   04919 Thyroid hormone signaling pathway
    112317273 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317273 (CCND1)
   05206 MicroRNAs in cancer
    112317273 (CCND1)
   05205 Proteoglycans in cancer
    112317273 (CCND1)
   05203 Viral carcinogenesis
    112317273 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112317273 (CCND1)
   05212 Pancreatic cancer
    112317273 (CCND1)
   05225 Hepatocellular carcinoma
    112317273 (CCND1)
   05226 Gastric cancer
    112317273 (CCND1)
   05214 Glioma
    112317273 (CCND1)
   05216 Thyroid cancer
    112317273 (CCND1)
   05221 Acute myeloid leukemia
    112317273 (CCND1)
   05220 Chronic myeloid leukemia
    112317273 (CCND1)
   05218 Melanoma
    112317273 (CCND1)
   05219 Bladder cancer
    112317273 (CCND1)
   05215 Prostate cancer
    112317273 (CCND1)
   05213 Endometrial cancer
    112317273 (CCND1)
   05224 Breast cancer
    112317273 (CCND1)
   05222 Small cell lung cancer
    112317273 (CCND1)
   05223 Non-small cell lung cancer
    112317273 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112317273 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112317273 (CCND1)
   04934 Cushing syndrome
    112317273 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112317273 (CCND1)
   05160 Hepatitis C
    112317273 (CCND1)
   05162 Measles
    112317273 (CCND1)
   05163 Human cytomegalovirus infection
    112317273 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112317273 (CCND1)
   05169 Epstein-Barr virus infection
    112317273 (CCND1)
   05165 Human papillomavirus infection
    112317273 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112317273 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112317273
NCBI-ProteinID: XP_024430129
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVDTIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPMKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAATTPHDFIEHFLSKMPVAEENRQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSSSFLSYHRLTRFLSKVIRCD
RDCLRACQEQIEALLEASLRQAQQQSLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcgcaccagctcctgtgctgcgaggtggataccatccgccgggcatacccggatgcc
aaccttctcaacgaccgggtgctgcgggctatgctcaaggcggaggagacctgcgcgccc
tccgtgtcctacttcaagtgtgtgcaaaaggagatcctgccgtccatgcgcaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccatgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccatccccctaacc
gcggagaagttgtgcatctacactgacaactccatccggcccgatgagctgctgcaaatg
gagctgctgctggtgaacaaacttaagtggaacctggcagccacaaccccgcacgatttc
atcgagcacttcctctccaagatgcctgtggctgaggagaacaggcagatcatccgcaaa
catgcgcagaccttcgtggctctctgtgccacagacgtgaagttcatttccaacccaccc
tccatggtggctgccggaagcgtggtggccgcagtgcaaggcctgcacctgggaagctcc
agcagcttcctgtcctatcaccgcctcactcgattcctctccaaagtgatcagatgtgac
cgggactgcctccgggcctgccaggagcagatcgaagccctactggaggccagcctgcgc
caggcccagcagcagagcctggaccccaaggctgccgaggaggaggaggaggaagaggag
gtggacctggcctgcacacccaccgacgtgcgggacgtgaacatttga

DBGET integrated database retrieval system