KEGG   Desmodus rotundus (common vampire bat): 112302085
Entry
112302085         CDS       T05907                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04022  cGMP-PKG signaling pathway
dro04141  Protein processing in endoplasmic reticulum
dro04151  PI3K-Akt signaling pathway
dro04211  Longevity regulating pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04668  TNF signaling pathway
dro04728  Dopaminergic synapse
dro04911  Insulin secretion
dro04915  Estrogen signaling pathway
dro04918  Thyroid hormone synthesis
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05020  Prion disease
dro05030  Cocaine addiction
dro05031  Amphetamine addiction
dro05034  Alcoholism
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112302085 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112302085 (ATF6B)
   04022 cGMP-PKG signaling pathway
    112302085 (ATF6B)
   04151 PI3K-Akt signaling pathway
    112302085 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112302085 (ATF6B)
   04915 Estrogen signaling pathway
    112302085 (ATF6B)
   04926 Relaxin signaling pathway
    112302085 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    112302085 (ATF6B)
   04918 Thyroid hormone synthesis
    112302085 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    112302085 (ATF6B)
   04925 Aldosterone synthesis and secretion
    112302085 (ATF6B)
   04927 Cortisol synthesis and secretion
    112302085 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112302085 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112302085 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    112302085 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112302085 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    112302085 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    112302085 (ATF6B)
   05031 Amphetamine addiction
    112302085 (ATF6B)
   05034 Alcoholism
    112302085 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112302085 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302085 (ATF6B)
   05161 Hepatitis B
    112302085 (ATF6B)
   05163 Human cytomegalovirus infection
    112302085 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112302085 (ATF6B)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112302085 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DUF4407 bZIP_Maf GIT_CC YabA NYD-SP28_assoc Docking
Other DBs
NCBI-GeneID: 112302085
NCBI-ProteinID: XP_024413399
LinkDB
Position
Unknown
AA seq 699 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDCTLYTGLDEVAEEQTQLFRCPEKDVPFGSSML
DVGMDVSPPEPPWDPLPLFPDLQVKSEPSSPRSNSSLSSESSRHSAEPSSQTPGVGEVLV
VKIESLAPPLCLLGDDPASLIETVQVNVGPTSDDPSDVQTKVEPVSPSSSINSEASLFSA
ESPSQAFIGEEILEVKTESPAPQGCLLRDVAGPPLGAVQIRVGPSDGSSGKALPARKPPL
QPKPVVITTVPVPPSAMPPSTTVLLQPLVQPPPVSPVVLLQGAIQVQPEGPAPPAPRPER
KSIVPAPMPGSSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLESRLQAVLADN
QQLRRENAALRRRLEALWAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPSATV
SPWMSGEEHRPRRHLLEFSAQLPIHGVEPLQGSSQGPEELQPRREGQPSFRNLTAFPGNA
KELLLRDLDHLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPRGAQKRQKSQRRK
NLPPVQAVPTQSPGPPERDSAGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLL
PAISHNKTSRPKMSLVMPAMAPNETLSGQGALGDYEEMMQIECEVMDTRVIHIKTSTVPP
SLRKQPSSTPGNATGGPLPASAAGQAHRATHRPFYLNHP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggagctaatgctcctcagcgaaattgcggacccgacgcgatttttcaccgacaac
ttgctgagcccggaggactgggactgcacgctgtacaccggcctggatgaggtggccgag
gagcagacgcagctcttccgttgcccggagaaggatgtcccgtttggcagcagcatgctg
gatgtggggatggatgtcagcccccccgaacccccgtgggaccccctgcctcttttccca
gatctacaggtgaagtctgagccatcttctccccgctccaactcctctctcagctccgaa
tcatcccgtcactctgcagagccctccagccagacccctggtgtaggggaggtgctggtt
gtgaagatagagtccttggcccccccgctctgcctcctgggagatgatccggcctccctc
atcgaaaccgtccaggtcaatgtgggccccacctccgatgatccctcagatgtccagacc
aaggtggagcctgtctccccatcttcctccatcaactctgaggcttccttgttctcagca
gagtcccccagccaggcgtttataggagaggaaatactagaagtgaagacagagtcccca
gcccctcaagggtgcctcctgcgggatgtcgcaggtcccccacttggagctgttcagatc
agagtgggtccgtccgatggctcctcaggcaaagccctgcctgcccggaagccaccactg
cagcctaaaccagtggtgataactactgtcccagtgccacccagcgccatgcctcccagc
accaccgtccttttgcagccccttgtccagccccctccagtgtccccagttgtccttctt
caaggtgctattcaagtccagcctgaggggccggccccccctgctccacggcctgagagg
aagagcattgttccagctcctatgcctgggagctcctgcccacctgaagtggacgcaaag
ctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcttgccagtccaggagg
aagaagaaggagtacctgcaggggctggagtctcggctacaggctgtgctcgccgacaac
cagcagctgcgccgcgagaacgctgccctccgccggcggctggaggccctgtgggctgag
aacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttcctt
ctcttcattgctttcaactttgggcctgtcagcatcagtgagcctccttcagctactgtc
tctccttggatgagcggagaggagcatcgaccccggagacacttgctggagttctcagca
cagttgcccattcatggagttgagcccctccagggctcctcccagggccccgaggagctg
cagccccgccgggagggccagccgagcttcaggaacctgacagccttccccgggaacgcc
aaggagctgctgctgagagacctggaccacctcttcctctcctcggattgccggcacttc
aaccgaactgagtccctgaggcttgctgatgagctgagcggctgggtgcagcgccaccag
agaggccggcggaagatgccccggggggcccagaagagacagaagtctcagcggcggaag
aatttgcctccagttcaggcagtccccacccaatcccccgggcccccggaaagggattct
gcgggccaactgcagctgtatcgccacccagaccgttcacagccagagttcctggatgca
attgaccgacgggaagacacgttttatgtggtctccttccggcgggaccacctgctactc
ccagccatcagccacaataagacctctcggcccaagatgtccctggtgatgcctgccatg
gcccccaatgagaccctgtcaggccagggggcccttggggactatgaggagatgatgcag
atcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgcccccc
tcgctccgaaaacagccgtcttcgaccccgggcaatgccacaggtggccccttgccagct
tctgcagccggccaggcccaccgggccacccatcggcccttctacctcaatcacccctga

DBGET integrated database retrieval system