KEGG   Desmodus rotundus (common vampire bat): 112302219
Entry
112302219         CDS       T05907                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04141  Protein processing in endoplasmic reticulum
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05160  Hepatitis C
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112302219 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112302219 (BAK1)
   04215 Apoptosis - multiple species
    112302219 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112302219 (BAK1)
   05202 Transcriptional misregulation in cancer
    112302219 (BAK1)
   05206 MicroRNAs in cancer
    112302219 (BAK1)
   05203 Viral carcinogenesis
    112302219 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112302219 (BAK1)
   05212 Pancreatic cancer
    112302219 (BAK1)
   05225 Hepatocellular carcinoma
    112302219 (BAK1)
   05226 Gastric cancer
    112302219 (BAK1)
   05214 Glioma
    112302219 (BAK1)
   05216 Thyroid cancer
    112302219 (BAK1)
   05220 Chronic myeloid leukemia
    112302219 (BAK1)
   05217 Basal cell carcinoma
    112302219 (BAK1)
   05218 Melanoma
    112302219 (BAK1)
   05213 Endometrial cancer
    112302219 (BAK1)
   05224 Breast cancer
    112302219 (BAK1)
   05222 Small cell lung cancer
    112302219 (BAK1)
   05223 Non-small cell lung cancer
    112302219 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    112302219 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112302219 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112302219 (BAK1)
   05160 Hepatitis C
    112302219 (BAK1)
   05164 Influenza A
    112302219 (BAK1)
   05162 Measles
    112302219 (BAK1)
   05168 Herpes simplex virus 1 infection
    112302219 (BAK1)
   05163 Human cytomegalovirus infection
    112302219 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112302219 (BAK1)
   05169 Epstein-Barr virus infection
    112302219 (BAK1)
   05165 Human papillomavirus infection
    112302219 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112302219 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dro03029]
    112302219 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dro02000]
    112302219 (BAK1)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    112302219 (BAK1)
Transporters [BR:dro02000]
 Other transporters
  Pores ion channels [TC:1]
   112302219 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 112302219
NCBI-ProteinID: XP_024413610
LinkDB
Position
Unknown
AA seq 274 aa
MASGQGPGPPGQGCEEPAPSSTSEEQVAQDTEEVFHSYVFYRHQQEQEADGVAAPADPEM
VTLPPEPASLMGQVGRQLAIIGDAINQRYDEEFQTMLHRLQPTTENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALYVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVSA
RHWQPLVCCRAAPVPVIPTSPSPLVPAYTASSSLTTLSLLAGGSPGLGQRPYPEHAGHSG
CGSVGPVCDTKILQVMTPGGALWGPSRDPYLDFS
NT seq 825 nt   +upstreamnt  +downstreamnt
atggcgtctgggcaaggaccaggccctcccgggcaggggtgtgaagagcctgccccatcc
tccacttcggaggagcaggtagcccaagacacagaggaggttttccacagctacgttttt
taccgccatcagcaggagcaggaggctgatggggtggctgcccccgctgacccagagatg
gtcaccttgcccccggaacctgccagcctcatggggcaggtgggtcggcagctcgccatc
atcggggacgccatcaaccagcgctatgacgaggagttccagaccatgctgcatcgcctg
cagccaactacggagaacgcctatgagtacttcaccaagatcgcctccagcctgtttgag
agtggcatcaactggggccgcgtggtggctctcttgggcttcggctaccgcctggccctg
tatgtgtaccagcgcggactgactggcttcctgggccaggtgacccgcttcgtggtggac
ttcatgctgcatcactgcattgcccggtggatcgcgcagaggggaggctgggtgagtgcc
cggcactggcagcctctcgtgtgctgccgggctgcccctgttccagtcattcctacctcc
cccagtcccttggtgcctgcgtacactgccagctcctctctgaccactctgtctctcctg
gcaggtggcagccctggacttggccaacggccctatccggaacatgctggtcattctggc
tgtggttctgttgggccagtttgtgatacgaagattcttcaagtcatgaccccaggaggg
gctctttggggtcccagcagagacccctacctggacttcagctaa

DBGET integrated database retrieval system