KEGG   Desmodus rotundus (common vampire bat): 112302262
Entry
112302262         CDS       T05907                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04012  ErbB signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04218  Cellular senescence
dro04630  JAK-STAT signaling pathway
dro04921  Oxytocin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112302262 (CDKN1A)
   04630 JAK-STAT signaling pathway
    112302262 (CDKN1A)
   04066 HIF-1 signaling pathway
    112302262 (CDKN1A)
   04068 FoxO signaling pathway
    112302262 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    112302262 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112302262 (CDKN1A)
   04115 p53 signaling pathway
    112302262 (CDKN1A)
   04218 Cellular senescence
    112302262 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112302262 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    112302262 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112302262 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    112302262 (CDKN1A)
   05206 MicroRNAs in cancer
    112302262 (CDKN1A)
   05205 Proteoglycans in cancer
    112302262 (CDKN1A)
   05203 Viral carcinogenesis
    112302262 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112302262 (CDKN1A)
   05212 Pancreatic cancer
    112302262 (CDKN1A)
   05225 Hepatocellular carcinoma
    112302262 (CDKN1A)
   05226 Gastric cancer
    112302262 (CDKN1A)
   05214 Glioma
    112302262 (CDKN1A)
   05216 Thyroid cancer
    112302262 (CDKN1A)
   05220 Chronic myeloid leukemia
    112302262 (CDKN1A)
   05217 Basal cell carcinoma
    112302262 (CDKN1A)
   05218 Melanoma
    112302262 (CDKN1A)
   05211 Renal cell carcinoma
    112302262 (CDKN1A)
   05219 Bladder cancer
    112302262 (CDKN1A)
   05215 Prostate cancer
    112302262 (CDKN1A)
   05213 Endometrial cancer
    112302262 (CDKN1A)
   05224 Breast cancer
    112302262 (CDKN1A)
   05222 Small cell lung cancer
    112302262 (CDKN1A)
   05223 Non-small cell lung cancer
    112302262 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112302262 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112302262 (CDKN1A)
   05161 Hepatitis B
    112302262 (CDKN1A)
   05160 Hepatitis C
    112302262 (CDKN1A)
   05163 Human cytomegalovirus infection
    112302262 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112302262 (CDKN1A)
   05169 Epstein-Barr virus infection
    112302262 (CDKN1A)
   05165 Human papillomavirus infection
    112302262 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112302262 (CDKN1A)
   01522 Endocrine resistance
    112302262 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112302262
NCBI-ProteinID: XP_024413660
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDPRPNPRGSKVCRRLFGPVDSEQLRRDCDALMASCVQEACERWNFDFVTETPLE
GDFAWERVWGPGLPKVCLPPGPRGIQDNLGGGRRCSSSPALLQGTAQEDHLDLSLSCTLV
PRSPERPEGSPGGPSTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtccgagccatcccgggatccccgcccgaacccccgtggcagcaaggtctgccgtcgc
ctcttcggcccagtggacagcgagcagctgcgtcgagactgtgacgcgctaatggccagc
tgcgtgcaggaggcgtgtgagcgatggaacttcgactttgtcacggagacgccactggag
ggtgacttcgcctgggagcgtgtgtggggcccgggcctgcccaaggtctgcctgccccca
gggcctcgggggatccaggacaacctgggaggaggcaggcggtgcagcagctcccctgcc
ctgctgcaggggaccgctcaggaggaccacctggacctgtcactgtcctgcaccctggtg
cctcgctcccctgagaggcctgagggctccccaggtgggcctagcacctctcagggccgg
aagcggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system