KEGG   Desmodus rotundus (common vampire bat): 112303034
Entry
112303034         CDS       T05907                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04915  Estrogen signaling pathway
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05211  Renal cell carcinoma
dro05212  Pancreatic cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05223  Non-small cell lung cancer
dro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112303034 (TGFA)
   04012 ErbB signaling pathway
    112303034 (TGFA)
   04014 Ras signaling pathway
    112303034 (TGFA)
   04151 PI3K-Akt signaling pathway
    112303034 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112303034 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303034 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112303034 (TGFA)
   05212 Pancreatic cancer
    112303034 (TGFA)
   05225 Hepatocellular carcinoma
    112303034 (TGFA)
   05214 Glioma
    112303034 (TGFA)
   05211 Renal cell carcinoma
    112303034 (TGFA)
   05215 Prostate cancer
    112303034 (TGFA)
   05223 Non-small cell lung cancer
    112303034 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112303034 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 112303034
NCBI-ProteinID: XP_024414265
LinkDB
Position
Unknown
AA seq 160 aa
MVTSAGQLALFALGVLLAVCQALENTTSALSANPPMAAAVVSYFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYIGARCEHADLLAVVAASQKKQAITALVVVSIVALAGLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacttcggctggacagctcgccctgttcgcgctgggtgttttgttggctgtgtgt
caggccctggagaacaccacatccgccttgagtgcaaacccacccatggccgcagctgtg
gtgtcttattttaatgactgcccggattcccacagtcagttctgctttcatggaacctgc
aggtttttggtgcaggaggacaagccagcgtgtgtctgccattctgggtacatcggagca
cgctgtgagcacgcagatctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttagtggtggtttccattgtagccttggctggcctcatcatcacgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccgacac
gagaaacccagtgcgctcctgaaaggaaggaccgcttgctgccactcggaaacagtggtc
tga

DBGET integrated database retrieval system