KEGG   Desmodus rotundus (common vampire bat): 112303349
Entry
112303349         CDS       T05907                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03420  Nucleotide excision repair
dro04115  p53 signaling pathway
dro04120  Ubiquitin mediated proteolysis
dro05161  Hepatitis B
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112303349 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    112303349 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112303349 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303349 (DDB2)
   05202 Transcriptional misregulation in cancer
    112303349 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112303349 (DDB2)
   05212 Pancreatic cancer
    112303349 (DDB2)
   05225 Hepatocellular carcinoma
    112303349 (DDB2)
   05226 Gastric cancer
    112303349 (DDB2)
   05214 Glioma
    112303349 (DDB2)
   05216 Thyroid cancer
    112303349 (DDB2)
   05220 Chronic myeloid leukemia
    112303349 (DDB2)
   05217 Basal cell carcinoma
    112303349 (DDB2)
   05218 Melanoma
    112303349 (DDB2)
   05213 Endometrial cancer
    112303349 (DDB2)
   05224 Breast cancer
    112303349 (DDB2)
   05222 Small cell lung cancer
    112303349 (DDB2)
   05223 Non-small cell lung cancer
    112303349 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112303349 (DDB2)
   05169 Epstein-Barr virus infection
    112303349 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112303349 (DDB2)
   03400 DNA repair and recombination proteins [BR:dro03400]
    112303349 (DDB2)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     112303349 (DDB2)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      112303349 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 112303349
NCBI-ProteinID: XP_024414681
LinkDB
Position
Unknown
AA seq 427 aa
MAPKKRPETRKTSEVALHPRSKRSRSPGELEHEAKKLCAKGPGSSRRSGPGCLREGLASL
QVPPPGRSIVRALHHHTLGRTAWPSLRQDLQQSFLNSLASYRIFQKAAPFDRRATSMAWH
PTNPSTLAVGSKGGDIMLWNFGTKDKPTFIKGIGAGGSITGLKFNPLNTNQFFISSMEGT
TRLQDFKGNILQVYTNYGTCNFWFCSLDVSAERRVVVTGDNVGHVVLLNLDGRELWNLRM
HKKKVTHVALNPCCDWFLVTASVDQTVKIWDLRQVKGKSSFLYSLPHRHPVNAAHFSPDG
VRLLTTDQKSEIRIYSASQWDRPPSLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSGTPHELRTIDVFDGSSGKLMHQLYDPESSGISSLNEFNPMGDTLASVMGYHILIWSQ
QETRTGK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacgcggaagacctccgaggtggctttacacccccgg
agcaagaggagccgaagccccggggagctggagcacgaggccaagaagctctgtgcgaag
ggccccggttctagcagaagatctggccccggctgccttcgggaggggttggctagcctg
caggtccctccaccgggcaggagcatcgtcagggccctccatcaccacacgctgggcaga
actgcctggccttcgctccggcaggatctccagcagtcctttctgaactctctggcttct
taccggatattccaaaaggctgccccctttgacaggagggccacatccatggcatggcac
ccgactaaccccagcaccctagctgtgggttccaaagggggagatatcatgctctggaac
tttggcacaaaggacaaacctaccttcattaaagggattggagctggagggagcatcact
gggctgaagtttaatcctctcaacaccaaccagtttttcatctcctcgatggagggaaca
actaggctacaagactttaaaggcaacattctccaagtttataccaactatggcacctgc
aacttctggttttgcagcctggatgtgtctgcagaaagacgagtggtggtcacaggagac
aacgtggggcacgtggtcctgctgaatctggacggcagggagctttggaatctgagaatg
cacaaaaagaaagttacccatgtggccctgaacccatgctgtgattggtttctggtcaca
gcctctgtagatcaaacagtgaaaatctgggacctgcgccaggttaaagggaaatccagc
tttctctactcgctgccacacaggcatcctgtcaatgcagctcatttcagtcccgatggc
gtccggctcctgaccaccgaccagaagagtgagatccggatttactcggcctcccagtgg
gaccgccctccaagcctgatcccacaccctcaccgccacttccagcacctgacacccatt
aaggcagcctggcatcctcggtacaacctcatcgttgtgggcagatacccagatcctaat
ttcaaaagtggtacccctcacgagttaagaacaattgatgtctttgatggaagctcaggg
aagttgatgcatcagctctatgacccagaatcttctggtatcagttcgctcaatgagttc
aatcctatgggggacacgctggcctctgtgatgggttatcacatactcatttggagccag
caggaaacaaggacggggaaatga

DBGET integrated database retrieval system