KEGG   Desmodus rotundus (common vampire bat): 112303893
Entry
112303893         CDS       T05907                                 

Gene name
BIRC7
Definition
(RefSeq) baculoviral IAP repeat-containing protein 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04120  Ubiquitin mediated proteolysis
dro04215  Apoptosis - multiple species
dro05145  Toxoplasmosis
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112303893 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    112303893 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112303893 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112303893 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112303893 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112303893 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112303893 (BIRC7)
Peptidases and inhibitors [BR:dro01002]
 Peptidase inhibitors
  Family I32: IAP family
   112303893 (BIRC7)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112303893 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4 zf-RING_5 DUF2039 zf-C3HC4_2 zf-RING_2
Other DBs
NCBI-GeneID: 112303893
NCBI-ProteinID: XP_024415228
LinkDB
Position
Unknown
AA seq 285 aa
MGPEERAQCWCCGPERSRWAAGGSPTGGHCGPCSLCGHIPGQDSDDTLWGGQDHMDGQIL
GQLRALVEEEEEDGAWAVPSSRPAFPEMGSEELRLASFCDWPPTTTVRPELLAAAGFFHT
GRQDKVRCFFCSGGLQTWERGDDPWTEHAKWFPRCEFLLRTKGRDFVCSVQESLRHPLAS
WVLAGSFQDRWEEPADAVPATSAPAHPTPREETRSAGAREPGAQDAEEQLRRLREERTCK
VCLDRTVGIVFVPCGHLVCTMCAPSLQLCPICRAPIHSCVRTFLS
NT seq 858 nt   +upstreamnt  +downstreamnt
atgggacccgaggaaagggcccagtgctggtgctgtggcccagagcggagtcgctgggca
gctggaggcagtcccacggggggacactgtggaccctgctccctgtgtggccacatcccg
ggccaggactctgacgacaccttgtggggaggccaggaccacatggacgggcagatcctg
ggccagctgcgtgccctggtggaagaggaggaagaggatggggcctgggctgtcccatcc
tcaaggcctgctttccctgagatgggctccgaggagctgcggctggcctccttctgtgac
tggccgccgaccaccactgtgcggcctgagctgctggccgctgccggcttcttccacacc
ggccgacaggataaggtgaggtgcttcttctgctccgggggtctgcagacctgggagcga
ggagatgacccctggactgagcacgccaagtggttccccaggtgtgaattcttgctccgg
accaaaggaagggactttgtctgcagcgtccaggagtccctccgccaccccctggcctcc
tgggtgctagccggctcttttcaggaccgatgggaggaacctgcagacgcagtccctgcc
acctcagctcctgcccaccccacacccagagaagagacccgctcagcgggtgccagggag
ccaggagcccaggacgcagaggagcagctgcggaggctgcgggaggagcggacctgcaag
gtgtgcctggaccgcactgtgggcatcgtcttcgtgccctgcggccacctggtctgcacc
atgtgtgcgcccagcctgcagctctgccccatctgcagggcccccatccacagctgcgtg
cgcaccttcctgtcctag

KEGG   Desmodus rotundus (common vampire bat): 112310530
Entry
112310530         CDS       T05907                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04064  NF-kappa B signaling pathway
dro04120  Ubiquitin mediated proteolysis
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04217  Necroptosis
dro04510  Focal adhesion
dro04621  NOD-like receptor signaling pathway
dro05145  Toxoplasmosis
dro05166  Human T-cell leukemia virus 1 infection
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112310530 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112310530 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112310530 (XIAP)
   04215 Apoptosis - multiple species
    112310530 (XIAP)
   04217 Necroptosis
    112310530 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112310530 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112310530 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112310530 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112310530 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112310530 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112310530 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112310530 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112310530 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112310530 (XIAP)
   03029 Mitochondrial biogenesis [BR:dro03029]
    112310530 (XIAP)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112310530 (XIAP)
Peptidases and inhibitors [BR:dro01002]
 Peptidase inhibitors
  Family I32: IAP family
   112310530 (XIAP)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112310530 (XIAP)
Mitochondrial biogenesis [BR:dro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    112310530 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 112310530
NCBI-ProteinID: XP_024422504
LinkDB
Position
Unknown
AA seq 497 aa
MTLNCFEGSKTCVPADIDKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFIKSFYFENNAAQPTNSGIQNGQYKADNC
LGNRNHFVLDRPSETHADYLLRTGQVVDLSDTIYPRYPAMCSEEARLKSFQHWPDYAHLT
PRELASAGLYYTGVDDQVQCFCCGGKLKNWEPRDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDIPSSDRNFPNSTNSPRNPAMADYEARISTFGMWMYSVNKEQLSRAGFYALGEGDRVKC
FYCGGGLSDWKPSEDPWEEHAKWFPGCKYLLEEKGQEYVNNIHLTHLLEESVGRNDEKTP
SLTKKIDDTILQNPMVHEAIRMGFNFRDIKKIMEEKIQTSRSNYKSLEALVADLVSVQKD
NTQDESSQTSLQKEISTEEQLRLLQEEKLCKICMDRNIAIVFIPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgactcttaactgttttgaaggatctaaaacttgtgtacctgcagacatcgataaagat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtagtagt
cctgtttcagcatcaacgctagcacgagctggttttctgtacactggtgaaggagacacc
gtgcggtgctttagttgtcacgcagcagtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaagagcttttattttgaaaat
aatgctgcgcaacctacaaattccggtattcagaatggtcagtacaaagccgataactgt
ctggggaacagaaaccattttgttttagacaggccgtctgagactcacgcagactatctt
ttgagaactggacaggttgtagatctgtctgacaccatctacccgaggtaccctgccatg
tgtagtgaagaagctagattaaagtcatttcagcactggccagattatgcccatttaacc
ccaagagagttagctagtgctgggctctactatacaggtgttgatgatcaagtgcagtgc
ttttgttgtggtggaaaactaaagaattgggaacctcgtgatcgagcatggtcagaacac
aggcgacattttcctaattgcttctttgttttgggccggaatgttaatattcgaagtgaa
tctgatatcccgagttctgataggaatttcccaaattcaacaaattctccaagaaatcca
gccatggcagattatgaagcacggatcagtacttttgggatgtggatgtactctgttaac
aaggagcagctttcaagagctggattttatgctttaggtgaaggtgatagagtcaagtgc
ttttattgtggaggaggtctaagtgattggaagcctagtgaagacccttgggaagaacat
gctaagtggtttccagggtgtaaatatctgttagaagagaagggacaagaatacgtaaac
aatattcatttaacccacttacttgaagagtctgtgggaagaaatgatgagaaaacacca
tcactaactaaaaaaattgatgataccatcctccagaatcctatggtgcatgaagctata
cgaatggggttcaatttcagggatattaagaaaataatggaggaaaaaattcagacatct
aggagcaactataaatcacttgaggctctggttgcagatctagtgagtgtgcagaaagac
aacacacaagatgaatcaagtcagacttccttgcagaaagagattagtactgaagagcag
ctaaggctcctgcaagaggagaagctttgcaaaatctgcatggatagaaatattgctata
gtgtttattccttgcggacatctggtcacttgtaaacagtgtgctgaagccgttgataaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Desmodus rotundus (common vampire bat): 112317519
Entry
112317519         CDS       T05907                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 3-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04064  NF-kappa B signaling pathway
dro04120  Ubiquitin mediated proteolysis
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04217  Necroptosis
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04621  NOD-like receptor signaling pathway
dro04668  TNF signaling pathway
dro05132  Salmonella infection
dro05145  Toxoplasmosis
dro05168  Herpes simplex virus 1 infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112317519
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112317519
   04064 NF-kappa B signaling pathway
    112317519
   04668 TNF signaling pathway
    112317519
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112317519
   04215 Apoptosis - multiple species
    112317519
   04217 Necroptosis
    112317519
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112317519
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112317519
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317519
   05202 Transcriptional misregulation in cancer
    112317519
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112317519
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112317519
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112317519
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112317519
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112317519
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112317519
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112317519
Peptidases and inhibitors [BR:dro01002]
 Peptidase inhibitors
  Family I32: IAP family
   112317519
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112317519
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 DUF2039 zf-C3HC4_2
Other DBs
NCBI-GeneID: 112317519
NCBI-ProteinID: XP_024430370
LinkDB
Position
Unknown
AA seq 604 aa
MNVVEDSKFLSNLMKNANMFELKYDFSCELFRMSTYSTFPTGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFVQKLNSGNISGATFQFNLPFSVTNS
THLLLPRSEENIGYFSGSYSSFPSSPANSEASQDISALRSPNHCLMNTENARLRTFQMWP
LTCPSPAELAKAGFYYIGPGDRVTCFACGGKLSNWEPNDDAMSEHLRHFPKCPFLESQPQ
DTSRYSISNLSMQTQAARFRTFCNWPASVPVHPQQLASAGFYYMGYNDDVKCFCCDGGLR
CWETGDDPWVEHAKWFPRCEYLIHVKGQEFISRIQASYPYLLEQLLSTSDNPEDENAESP
IIHYGPGENRSEDAVMMNTPVVKAALEMGFSRSLVKQTVQSKILATGENYKVVSDLVLDL
LNAEDEIREEEKEKATEEEESDDLSCIRKNRMALFQHLTCVLPILDSLRIARVINEQEHE
VIKQKTQTYLQARELIDTIIVKGNFAATIFRKSLQETDPVLYKRLFVRQDIKYIPTENIS
DLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLAVCKDCAPSLRRCPICRGTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacgtagtagaagacagcaagttcttatcaaatctgatgaaaaacgccaacatgttt
gaattgaaatacgacttttcatgtgaactattccgaatgtctacgtattcgactttcccc
accggcgttcctgtgtcagaaaggagtcttgctcgtgctgggttttattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaacaaggagac
aaccctattgaaaagcataaaaagttgtatcctagctgtagctttgttcagaaactaaat
tcaggtaacatttcgggagccacctttcagtttaatttgcctttttcagtaacaaattcc
acacatttattacttccacgttcagaagaaaatattggttatttcagtggctcttattca
agctttccctcaagtcctgcaaactccgaagcaagtcaagatatttctgccttgagaagt
cccaaccattgcctaatgaatactgaaaacgccagattacgtactttccagatgtggcca
ttgacctgcccgtcgccagcagaactggcaaaagcaggtttttactacataggacctgga
gacagagtgacttgctttgcctgtggtggaaaattgagcaactgggagccaaatgatgat
gctatgtcagaacacctgagacatttccccaaatgcccatttttagagagtcagcctcaa
gacacttcaagatacagtatttctaatctgagcatgcagacacaggcagcccgttttaga
accttctgtaactggcccgctagtgttccagttcatcctcagcagcttgcaagtgccggt
ttttattatatgggttacaacgatgatgtcaaatgcttttgctgtgatggcggactgagg
tgttgggaaactggagatgacccatgggtggaacatgccaagtggtttcctaggtgtgag
tacttgatacacgttaaaggacaagagttcatcagtcgaattcaagccagttacccctat
ctgcttgaacagctgttatctacttcagacaatccagaagatgaaaatgcagagtcgcca
attattcattatggaccaggagaaaaccgttcagaagatgcagtcatgatgaatacacct
gtggttaaagctgctttggaaatgggcttcagtagaagcctggtaaaacagacagttcag
agtaaaatcctggcaactggagagaattacaaagtcgtcagtgatcttgtactagattta
cttaatgctgaagatgaaataagggaagaggagaaagaaaaagcaactgaggaagaagaa
tcagatgatctatcatgtatccggaaaaatagaatggcactttttcagcatttgacttgt
gtgcttccaattttggatagtctacggattgccagagtgattaatgaacaagaacatgaa
gttattaaacagaaaacacagacatatttgcaagcaagagaactgattgatactattata
gtaaaaggaaattttgcagccaccatattcagaaagtctctacaagaaactgaccctgta
ttatacaagcgtttatttgtgcgacaggacataaagtatattcccacagaaaatatttca
gatttaccaatggaagagcaattgaggagactgcaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtctatagtgttcattccttgtggtcatctagcagtatgcaaagac
tgtgccccttccctaagaagatgtcctatttgtagaggtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Desmodus rotundus (common vampire bat): 112317544
Entry
112317544         CDS       T05907                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04064  NF-kappa B signaling pathway
dro04120  Ubiquitin mediated proteolysis
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04217  Necroptosis
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04621  NOD-like receptor signaling pathway
dro04668  TNF signaling pathway
dro05132  Salmonella infection
dro05145  Toxoplasmosis
dro05168  Herpes simplex virus 1 infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112317544
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112317544
   04064 NF-kappa B signaling pathway
    112317544
   04668 TNF signaling pathway
    112317544
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112317544
   04215 Apoptosis - multiple species
    112317544
   04217 Necroptosis
    112317544
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112317544
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112317544
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317544
   05202 Transcriptional misregulation in cancer
    112317544
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112317544
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112317544
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112317544
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112317544
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112317544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112317544
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112317544
Peptidases and inhibitors [BR:dro01002]
 Peptidase inhibitors
  Family I32: IAP family
   112317544
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112317544
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 112317544
NCBI-ProteinID: XP_024430390
LinkDB
Position
Unknown
AA seq 619 aa
MHKTTSQRLIPGPSYQKIKSIMEDRTILSNRTIDNKHKMKYDFSCELYRMSTYSTFPIGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLVSVT
RLESTFKNTSPMRNSFTHSLSPVLEQSGSFSGSCSNLSSNPIDSRAVEDISPLRTNPYSY
AMSTEQARFLTFHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGTLSNWEPKDDAMSE
HRRHFPNCPFLENSLETLRFSISNLSMQTHAARLRTFMYWPSSVPVQPEQLASAGFYYVG
RNDDVKCFCCDGGLRCWEPGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQL
LSTSDPPGDENAEPPIVHFGPGESSSEDAVMMNTPVVKAALEMGFSRSLVKQTVQSKILT
TGENYKTVNDIVSALLNAEDEKRQEEKERQTEEMASDDLSLIRKNRMALFQQLTCVLPIL
DNLLKANIINKQEHDIIKQKTQIPLQARELIDTVLVKGNAAANIFKSCLKEIDSTLYKNL
FVEKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSL
RKCPICRGIIKGTVRTFLS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcacaaaactacctcccaacgacttatcccaggtccctcgtatcaaaaaattaagagc
ataatggaagatcgcacgatcttgtcaaatcggacaatcgacaacaaacacaaaatgaaa
tacgacttttcatgtgagctctacagaatgtctacgtattcgactttccccatcggcgtt
cctgtgtcagaaaggagtcttgctcgtgctgggttttattacactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaacaaggagacaatcctatt
gaaaagcataaacagctctatcctagctgtagctttattcagaatctcgtttcggttact
aggttggaatccacctttaaaaatacttctccgatgagaaacagttttacgcattcatta
tctcctgttttggaacaaagtggctcattcagtggctcttgcagcaacctttcatcaaac
cctatcgattctagagccgttgaagatatctccccgttgaggactaatccctacagttac
gcaatgagtactgaacaagccagatttcttactttccatatgtggccattaaccttcttg
tcaccttcagaattggcaagagctggtttttattacataggacctggagatagggtagcc
tgctttgcttgtggtgggacactgagtaactgggaaccaaaggacgatgctatgtcagaa
caccggagacatttccccaactgtccatttttggaaaattctctagaaacgctgaggttt
agcatttcaaatttgagcatgcagacacatgcagcccgactgagaacatttatgtactgg
ccatctagtgttccagttcaacctgagcagcttgcaagtgctggtttctattatgtgggt
cgcaacgatgatgtcaaatgcttttgttgtgatggtggcttaaggtgttgggaacctgga
gatgacccatgggtagaacatgccaaatggtttccaaggtgtgagttcctgatacgcatg
aaagggcaggagtttgttgatgagattcaagctagatatcctcatcttcttgaacagctg
ttgtcaacttcagaccctcctggagatgaaaatgctgagccaccaattgttcattttgga
cctggagaaagttcttcagaagatgcagtcatgatgaatacacctgtggttaaagctgct
ttggaaatgggcttcagtagaagcctggtaaaacagacagttcagagtaaaatcctaaca
actggagagaattacaaaacagttaatgatattgtgtcagcacttcttaacgctgaagat
gaaaaaagacaagaggaaaaggaaagacaaactgaagaaatggcgtcagatgatttgtca
ttaattcggaagaatagaatggctctctttcagcagttgacctgtgtgcttcctatcctg
gataatcttttaaaggccaatattattaataaacaagaacatgatataattaaacaaaaa
acacagatacctttacaagcaagagaactgattgatactgttttagttaaaggaaatgct
gcagccaacatctttaaaagctgtctaaaagaaattgactctacattatataagaactta
tttgtggaaaaaaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaa
gaacaattgaggaggctgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtt
tctattgtgttcattccttgtggtcatctggtagtgtgccaggaatgtgccccttctctg
agaaaatgccctatttgcaggggtataattaagggtactgttcgtacatttctctcgtga

DBGET integrated database retrieval system