KEGG   Desmodus rotundus (common vampire bat): 112303920
Entry
112303920         CDS       T05907                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04015  Rap1 signaling pathway
dro04062  Chemokine signaling pathway
dro04137  Mitophagy - animal
dro04144  Endocytosis
dro04360  Axon guidance
dro04370  VEGF signaling pathway
dro04510  Focal adhesion
dro04520  Adherens junction
dro04530  Tight junction
dro04540  Gap junction
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04625  C-type lectin receptor signaling pathway
dro04727  GABAergic synapse
dro04750  Inflammatory mediator regulation of TRP channels
dro04810  Regulation of actin cytoskeleton
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro05100  Bacterial invasion of epithelial cells
dro05135  Yersinia infection
dro05152  Tuberculosis
dro05161  Hepatitis B
dro05163  Human cytomegalovirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05219  Bladder cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112303920 (SRC)
   04015 Rap1 signaling pathway
    112303920 (SRC)
   04370 VEGF signaling pathway
    112303920 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112303920 (SRC)
   04137 Mitophagy - animal
    112303920 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112303920 (SRC)
   04520 Adherens junction
    112303920 (SRC)
   04530 Tight junction
    112303920 (SRC)
   04540 Gap junction
    112303920 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112303920 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112303920 (SRC)
   04613 Neutrophil extracellular trap formation
    112303920 (SRC)
   04625 C-type lectin receptor signaling pathway
    112303920 (SRC)
   04062 Chemokine signaling pathway
    112303920 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112303920 (SRC)
   04915 Estrogen signaling pathway
    112303920 (SRC)
   04917 Prolactin signaling pathway
    112303920 (SRC)
   04921 Oxytocin signaling pathway
    112303920 (SRC)
   04926 Relaxin signaling pathway
    112303920 (SRC)
   04919 Thyroid hormone signaling pathway
    112303920 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    112303920 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112303920 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    112303920 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112303920 (SRC)
   05203 Viral carcinogenesis
    112303920 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    112303920 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112303920 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112303920 (SRC)
   05152 Tuberculosis
    112303920 (SRC)
   05100 Bacterial invasion of epithelial cells
    112303920 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112303920 (SRC)
   05168 Herpes simplex virus 1 infection
    112303920 (SRC)
   05163 Human cytomegalovirus infection
    112303920 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112303920 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112303920 (SRC)
   01522 Endocrine resistance
    112303920 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112303920 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112303920 (SRC)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112303920 (SRC)
Protein kinases [BR:dro01001]
 Non-receptor tyrosine kinases
  SRC family
   112303920 (SRC)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    112303920 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    112303920 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112303920 (SRC)
  Macropinocytosis
   Kinases
    112303920 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 112303920
NCBI-ProteinID: XP_024415257
LinkDB
Position
Unknown
AA seq 537 aa
MGSNKSKPKDASQRRRSLEPAENTHGGGSGGAFPTFQTPSKPASADGHRGPSMALSPEAA
EPKLFGGFNTLDTVTSPQRAGPLAAGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEG
DWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRE
SETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADG
LCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKT
LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGK
YLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVE
RGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccaacgccgccgaagcctggagcct
gctgagaacacccatggtggcggcagcgggggcgccttccccaccttccagacccccagc
aagccggcctccgctgatggccaccgaggccccagcatggccttgtcccctgaggccgca
gagcccaagctgtttggaggcttcaacaccttagacacagtcacctccccgcagagggcg
gggcccctggccgctggagtgaccacctttgtggccctctatgactatgagtcacggaca
gagaccgacctgtccttcaagaaaggggagcggctgcagattgtcaacaacacagaggga
gactggtggctggcccactcgctcagcacgggacagacgggctacatccccagcaactac
gtggcgccctccgactccatccaggctgaggagtggtactttggcaaaatcacgagacgg
gagtcagaacgattactactcaatgcagagaacccgagggggaccttcctggtgcgagaa
agtgagaccacaaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggc
ctcaatgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctct
cgcacgcagttcaacagtctgcagcagctcgtagcctactactccaaacatgctgatggc
ctgtgccaccgactcaccactgtgtgccccacatccaagccacagactcagggcctggcc
aaggatgcctgggagatcccccgggagtcactgcggctggaggtcaagctgggccagggc
tgctttggagaggtgtggatggggacctggaatggcaccaccagagtggccatcaaaacc
ctgaagccaggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaaa
ctgaggcatgagaagctggtgcagctgtacgcggtggtgtctgaggagcccatctacatc
gtcacggagtacatgagcaaggggagtttgctggactttctcaagggggagacgggcaag
tacctgaggctgcctcaactggtggacatggctgctcagatcgcttcaggcatggcatac
gtggagcgcatgaactatgtccaccgggacctgcgtgctgccaacatcctggtgggagag
aacctcgtgtgcaaagtggccgacttcggcctggctcggctcatcgaggacaacgagtac
acagcccggcaaggtgccaaattccccattaagtggacagctccagaagctgccctgtac
ggccggttcaccatcaagtcagacgtgtggtcctttgggatcctgctgacggagctcacg
acaaagggacgggtgccctaccctgggatggtaaaccgtgaggtgctggaccaggtggag
cggggctaccggatgccctgccccccggagtgtcccgagtccctgcacgacctcatgtgc
cagtgctggcggaaggagccggaggagcggcccaccttcgaatacctgcaggccttcctg
gaggactatttcacatccacggagccccagtaccagcctggagagaacctatag

DBGET integrated database retrieval system