KEGG   Desmodus rotundus (common vampire bat): 112304047
Entry
112304047         CDS       T05907                                 

Gene name
RBL1
Definition
(RefSeq) retinoblastoma-like protein 1
  KO
K04681  retinoblastoma-like protein 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04218  Cellular senescence
dro04350  TGF-beta signaling pathway
dro05165  Human papillomavirus infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112304047 (RBL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112304047 (RBL1)
   04218 Cellular senescence
    112304047 (RBL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112304047 (RBL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112304047 (RBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112304047 (RBL1)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    112304047 (RBL1)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 ATLF
Other DBs
NCBI-GeneID: 112304047
NCBI-ProteinID: XP_024415408
LinkDB
Position
Unknown
AA seq 1067 aa
MFEDDPQDEGAAVVAEAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTIIFKKFEPIFLDIFQNPYEETPKLPRSRKQRRTPCTVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIICPNRRDLLNPSFKGLPSDFHTADFR
APEEPPCVIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFAGDTPLGKLTAQANVECNLQHHFE
KKSFAPSTPLTGRRYLREKEAAITPVASATQSVSRLQSVVTGMKNAPSEQLTSIFESCMR
NPMENIMKIVKEIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETR
RLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVI
RSEEGLSRDMVKHLNSIEEQILESLAWNHNSALWEALQASANKVPTCEEVIFPNNFETGN
GGNIQGHLPMMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPAAGSAKRRLF
GEDPPKEVLMDRIITEGKKLKIAPSSSITAENISISPGQSLLTMATAIVTGTTGHKVTIP
LHGIANDAGEITLIPLSMNTTPESRVESPISLTAQSLSGASPKQTHLTKAQEVHPTGLSR
PKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLD
QLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVTYDKKINGD
FEMTDCDLEDGTNTPDCSSAPVREERGDLIKFYNTVYVGRVKSFALKYDLSNQDHMMEAP
PLSPFPYIKQQPGSPRRISQQHSIYVSPHKNGPGLTPRTALLYKFNGSPSKSLKDINNMI
RQGEQRTKKRAIAIDGDAESPAKRLCQENDDVLLKRLQDVVSERANH
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgttcgaggacgacccccaagacgagggggcagcggtggtcgccgaggccggggaggcg
cttcaggccttgtgccaagagctgaacctggacgaggggagcgcggccgaagccctggac
gacttcaccgccatcaggggcaactacagcctagagggagaagttatacactggttggca
tgttcattatacgttgcatgccgcaaaagcattattcccacagttggaaagggtatcatg
gaaggaaattgtgtttcacttaccagaatactacgttcagctaaattaagtttaatacag
ttttttagtaaaatgaagaaatggatggacatgtcaaacctgccacaagaatttcgtgaa
cgtatagaaagactagaaagaaattttgaggtgtctactataattttcaagaaatttgag
ccaatttttttagatatatttcaaaatccatatgaagaaacaccaaagttaccacgaagc
aggaagcagaggaggactccttgcactgttaaggatctctttaatttctgttggacactc
tttgtttatactaagggtaattttcgtatgattggagatgatttagtaaactcttatcat
ttgcttctgtgctgcttggatctgatttttgccaatgccattatatgcccaaatagacga
gacttgctaaatccatcatttaaaggtttaccatctgatttccacactgctgacttcagg
gctcctgaagagcctccctgtgtcattgctgtgctgtgtgaactgcatgatggacttcta
gtagaagcaaaaggaataaaggagcactactttaagccatatatttcaaaactctttgac
aggaagattttaaaaggagaatgcctcctggacctttccagttttactgataatagcaaa
gcagtgaacaaggaatatgaagaatacgttttaactgttggtgattttgacgagaggatc
tttttgggagcagatgcagaagaggaaattggaactcctcgaaagtttgctggtgacacc
ccactagggaaactgactgcacaggctaatgtggagtgtaaccttcagcaccacttcgaa
aaaaaatcattcgcaccttctaccccactgacaggacggcggtatttacgagaaaaagaa
gcagccattactcctgtagcttcggccactcagagtgtgagccggttacagagtgttgtg
actgggatgaaaaatgcaccaagtgaacaacttacaagtattttcgaatcttgtatgcgt
aatcccatggaaaatattatgaaaatagtgaaagaaataggagagactttctgtcaacac
tacactcaatcaacagatgagcaaccaggatctcacatagactttgctgtaaacagacta
aagcttgcagaaattttgtattataaaatattagagactgtaatggttcaggaaacacga
agacttcatggaatggacatgtcagttcttttagagcaagatatatttcatcgttccttg
atggcttgttgtttggaaattgtgctctttgcctatagctcacctcgtacttttccctgg
attattgaagttctcaatttgcagccattttatttttataaggttatcgaggtggtgatc
cgctcagaggagggactttccagggacatggtgaaacacctgaacagcatcgaagaacag
attctggagagtttagcctggaatcacaattctgcactatgggaggctctccaggcttct
gcaaacaaagttcctacttgtgaagaagttatatttccaaataactttgaaacaggaaat
gggggaaatatacagggacatcttcccatgatgccaatgtctccgctaatgcatccaagg
gtgaaagaagttcgtacagacagcggaagtcttcgaagggatatgcaaccattgtctcca
atttctgttcacgaacgctatagttctcctgctgcagggagtgctaagagaagacttttt
ggggaggaccccccaaaggaagtgcttatggacaggattataacagaaggaaaaaaattg
aaaattgccccttcttcaagcattacagctgaaaacatatcaatttcacctgggcaaagt
cttctaacaatggccacagccatagtaacggggacaacaggacataaagttacaatccca
ttgcatggtattgcaaatgatgctggggagatcacactgataccactttccatgaacaca
actccagagtccagagttgagagtcctatatcacttactgctcagtcattaagtggtgct
tctccaaaacaaactcatctgactaaagcacaagaggtacatccaactggactaagcaga
ccaaagagaactgggtccttagcactcttttatagaaaggtctatcacttggcaagtgta
cgcttacgtgatttatgtttaaaactggatgtttcaaatgagttacgaaggaagatatgg
acgtgttttgaattcactttagttcactgccctgacctaatgaaagacagacatttggat
cagctccttctttgtgccttttacatcatggcaaaggtaacaaaagaagaaagaactttt
caagaaataatgaaaagttataggaatcagccccaagctaatagtcacgtctatagaagt
gttctgttgaaaagtattccaagagaagttgtgacttacgataaaaaaataaatggtgat
tttgaaatgacagattgtgacttggaagatggtacaaacacacctgattgctccagtgca
ccggtgagagaggagagaggcgatcttatcaaattttacaatacagtatatgtaggaaga
gtgaagtcatttgcattgaagtatgacttgtcaaatcaggaccacatgatggaagctcca
ccactctctccttttccatatattaagcaacagccaggctcaccacgccgaatttcccag
cagcactccatctacgtttccccgcacaagaatgggccaggccttacccctcggactgct
ctgctgtataagttcaatggcagcccttctaagagtttgaaagatatcaacaacatgata
aggcaaggtgaacagagaaccaagaagcgagcaatagccatcgatggtgatgcagaatca
cctgccaaacgcctctgtcaagaaaatgatgatgttttacttaaaagactacaggatgtt
gtcagtgaaagagcaaatcattag

DBGET integrated database retrieval system