KEGG   Desmodus rotundus (common vampire bat): 112304122
Entry
112304122         CDS       T05907                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04062  Chemokine signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04310  Wnt signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04621  NOD-like receptor signaling pathway
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04728  Dopaminergic synapse
dro04730  Long-term depression
dro04742  Taste transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05022  Pathways of neurodegeneration - multiple diseases
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05146  Amoebiasis
dro05163  Human cytomegalovirus infection
dro05200  Pathways in cancer
Module
dro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112304122 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112304122 (PLCB4)
   04310 Wnt signaling pathway
    112304122 (PLCB4)
   04371 Apelin signaling pathway
    112304122 (PLCB4)
   04020 Calcium signaling pathway
    112304122 (PLCB4)
   04070 Phosphatidylinositol signaling system
    112304122 (PLCB4)
   04072 Phospholipase D signaling pathway
    112304122 (PLCB4)
   04071 Sphingolipid signaling pathway
    112304122 (PLCB4)
   04022 cGMP-PKG signaling pathway
    112304122 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112304122 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112304122 (PLCB4)
   04613 Neutrophil extracellular trap formation
    112304122 (PLCB4)
   04621 NOD-like receptor signaling pathway
    112304122 (PLCB4)
   04062 Chemokine signaling pathway
    112304122 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    112304122 (PLCB4)
   04922 Glucagon signaling pathway
    112304122 (PLCB4)
   04929 GnRH secretion
    112304122 (PLCB4)
   04912 GnRH signaling pathway
    112304122 (PLCB4)
   04915 Estrogen signaling pathway
    112304122 (PLCB4)
   04921 Oxytocin signaling pathway
    112304122 (PLCB4)
   04926 Relaxin signaling pathway
    112304122 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    112304122 (PLCB4)
   04918 Thyroid hormone synthesis
    112304122 (PLCB4)
   04919 Thyroid hormone signaling pathway
    112304122 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    112304122 (PLCB4)
   04916 Melanogenesis
    112304122 (PLCB4)
   04924 Renin secretion
    112304122 (PLCB4)
   04925 Aldosterone synthesis and secretion
    112304122 (PLCB4)
   04927 Cortisol synthesis and secretion
    112304122 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112304122 (PLCB4)
   04270 Vascular smooth muscle contraction
    112304122 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    112304122 (PLCB4)
   04971 Gastric acid secretion
    112304122 (PLCB4)
   04972 Pancreatic secretion
    112304122 (PLCB4)
   04973 Carbohydrate digestion and absorption
    112304122 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    112304122 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    112304122 (PLCB4)
   04725 Cholinergic synapse
    112304122 (PLCB4)
   04728 Dopaminergic synapse
    112304122 (PLCB4)
   04726 Serotonergic synapse
    112304122 (PLCB4)
   04720 Long-term potentiation
    112304122 (PLCB4)
   04730 Long-term depression
    112304122 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    112304122 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    112304122 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    112304122 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112304122 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112304122 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112304122 (PLCB4)
   05016 Huntington disease
    112304122 (PLCB4)
   05017 Spinocerebellar ataxia
    112304122 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    112304122 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112304122 (PLCB4)
   04934 Cushing syndrome
    112304122 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112304122 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112304122 (PLCB4)
   05142 Chagas disease
    112304122 (PLCB4)
   05143 African trypanosomiasis
    112304122 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112304122 (PLCB4)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112304122 (PLCB4)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112304122 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112304122 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 XRN1_D2_D3 EF-hand_6
Other DBs
NCBI-GeneID: 112304122
NCBI-ProteinID: XP_024415514
LinkDB
Position
Unknown
AA seq 1212 aa
MVLNIIMAKPYEFNWQKEVPSFLQEGAIFDRYEEESFLFEPNCLFKVDEFGFFLTWKSEG
KEGQVLECSLINSIRLGATPKDPKILAALEAVGKSESDLEGRIVCVCSGTDLVNISFTYM
VAENLEVTKQWVDGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFA
SGKTEKVIFQALKELGLPSGKNDEIEPAAFTFEKFYELTQKICPRTDIEDLFKKINGDKT
DYLTVDQLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIEMYEPDEDLKQKGLISSDGFCR
YLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYKQVLLAGC
RCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSK
YQQYKMSKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQL
EALKSMMEAGESAAPVNILEDYNEEETENADQEEEAHPEYKYGNELSADDLGHKEAVANS
VKKVSDDLEHEINKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHV
AEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNA
GCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAAT
CSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKV
ILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKT
YVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAK
TNVTPQSSSELRPTTTTALGSGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSL
KKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKI
QTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQT
QQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEER
KRLAMKQSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQ
TSNSSVKLQNTN
NT seq 3639 nt   +upstreamnt  +downstreamnt
atggtcttgaatataatcatggccaaaccttatgaatttaactggcagaaggaagttcct
tcctttttgcaagaaggagcaatttttgacagatatgaagaggaatcctttctgtttgaa
cccaactgcctcttcaaagtggatgaatttggcttctttctgacctggaaaagtgaaggc
aaggaaggacaagtgctagaatgctccctcatcaacagtattcggttgggagccacacca
aaggatcccaaaatcctggctgcccttgaagctgttggaaaatcagaaagtgatctggaa
gggcggatagtttgtgtctgcagtggaacggatctggtgaacatcagtttcacgtacatg
gtggctgaaaacctagaagtgactaagcaatgggtagatggcctaagatcaatcatacac
aacttcagggccaacaacgtcagtccgatgacatgcctcaagaaacactggatgaaattg
gcatttatgaccaacacaaatggtaaaatcccagttaggagtattactagaacctttgca
tcggggaaaacagaaaaggtgatctttcaagcactgaaggagttaggtcttcccagtgga
aagaatgatgaaattgagcctgcagcttttacttttgaaaagttctatgaactgacacaa
aagatttgtcctcggacagatatagaggatctttttaaaaaaatcaatggagacaaaact
gattatttaacggtagaccaattagtgagctttctaaatgaacatcaacgagaccctcga
ctgaatgaaattttattcccgttttacgacactaaaagggcaatgcagatcattgagatg
tatgagcctgatgaagacttgaagcaaaaaggccttatatcaagtgatggattttgcaga
tatctgatgtcagatgaaaatgcacccgtcttcctagatcgtttagaactttaccaagaa
atggaccatcctctggctcactacttcatcagttcttcccacaacacctatctcactggc
cgacaattcggcgggaaatcttcagtagaaatgtataaacaggttctcctggctgggtgc
agatgtgtggaactcgactgctgggatgggaagggcgaagaccaggaaccaataataact
cacgggaaagcgatgtgcacagatatcctcttcaaggatgttattcaagccatcaaggaa
actgcatttgtcacatctgaatatcctgtaattctctcctttgaaaatcactgcagcaaa
tatcaacagtacaagatgtccaaatattgcgaagatctatttggggatctcctgttgaaa
caagcactcgaatcccatccactcgaaccaggcaggccgttgccatcccccaatgacctc
aaaagaaaaatactcatcaaaaataaacgactgaaacctgaggttgaacaaaagcagctc
gaagctttgaaaagcatgatggaagctggagaatccgctgctccagttaacatcttagag
gattacaatgaggaggaaacagaaaatgctgaccaagaagaagaagctcaccctgaatac
aaatatggaaatgaactttctgctgatgacttgggtcacaaggaagctgttgcaaatagt
gtcaagaaggtttctgatgaccttgaacatgaaatcaacaaaaagggcctggttactgta
gaagatgagcaggcatggatggcatcttataaatatgtaggtgctaccaccaatatccat
ccatatttgtccacaatgatcaactatgcacagcccgtgaagtttcaaggtttccacgtt
gctgaagaacgcaatattcattataacatgtcttcttttaacgagtccgtcggtctaggc
tacttgaagacacacgcgattgaatttgtgaattataacaaacggcaaatgagtcgcatt
taccccaagggaggccgagtcgattccagtaattacatgcctcagattttctggaacgct
ggctgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattgaatcag
gggaaatttgagtataatggatcgtgcgggtaccttctcaaaccagatttcatgagacgg
cctgatcgaacgtttgatcctttctctgagacccctgtcgatggggttattgcagccacg
tgctcagtgcaggtcatatcaggccaattcttatcagataagaaaatcggcacatatgta
gaagtggacatgtatgggctgcccacagacactatacgtaaggaattccgaactcgcatg
gtgatgaacaacggactcaatccggtttacaatgaagaatcattcgtgtttcggaaggta
atcctccctgacctggcagtcttgagaatagcagtgtatgatgacaacaacaagctcatt
ggccagaggattctcccactggacggcctccaagccggctatcgacacatttcccttcga
aatgaggggaataaacctttatcactgccaacaattttctgcaatattgttcttaaaaca
tatgtgcctgatggatttggagatattgtggatgctttatcagatccaaagaagtttctt
tcaattacggaaaaaagagcagaccaaatgagagctatgggcatcgaaactagtgacata
gccgatgtgcccagtgacacttctaagaatgacaagaaaggaaaggccaacactgccaaa
acaaatgtgactccgcagagcagctctgaactcagaccaaccaccacgaccgccctgggg
tctggcatggaagccaaaaaaggtattgaacttatccctcaagtgaggatagaagattta
aagcagatgaaggcttacttgaagcatttaaagaaacagcagaaggaattaaattcttta
aaaaagaaacatgcaaaggagcacagtaccatgcagaagttacactgcacacaagtggac
aaaattgtggcccagtacgacaaagagaagtccactcatgaaaaaatcctggagaaggca
atgaagaagaaagggggaagtaattgtcttgaaatgaaaaaagaaacagaaattaaaatt
cagacactgacatcagatcacaaatctaaggtcaaggagattgtggcacagcacacaaaa
gagtggtcagagatgatcaacacgcacagcgctgaggagcaggaaatccgggacctgcac
ctgagccagcagtgcgagctgctgagaaagctcctgatcaacgcccatgagcagcaaacc
cagcagctgaaactgtcccatgacagggaaagcaaggaaatgagagcacaccaggctaag
atctctatggaaaatagcaaagccatcagccaagataaatctatcaagaacaaagcagaa
cgggaaaggcgagtcagggagttaaacagcagcaacactaaaaagtttctggaagaaaga
aagagactcgcaatgaaacagtccaaagaaatggatcagttgaaaaaagtccagcttgaa
cacctagagttcctagagaagcaaaacgagcagcttttgaaatcctgtcatgcagtgtcc
caaactcaaggcgaaggagatgcagcagatggtgaaattggaagccgagatggaccgcag
accagcaacagtagtgtgaaactccagaacacaaactga

KEGG   Desmodus rotundus (common vampire bat): 112304255
Entry
112304255         CDS       T05907                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04062  Chemokine signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04310  Wnt signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04621  NOD-like receptor signaling pathway
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04728  Dopaminergic synapse
dro04730  Long-term depression
dro04742  Taste transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05022  Pathways of neurodegeneration - multiple diseases
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05146  Amoebiasis
dro05163  Human cytomegalovirus infection
dro05200  Pathways in cancer
Module
dro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112304255 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112304255 (PLCB1)
   04310 Wnt signaling pathway
    112304255 (PLCB1)
   04371 Apelin signaling pathway
    112304255 (PLCB1)
   04020 Calcium signaling pathway
    112304255 (PLCB1)
   04070 Phosphatidylinositol signaling system
    112304255 (PLCB1)
   04072 Phospholipase D signaling pathway
    112304255 (PLCB1)
   04071 Sphingolipid signaling pathway
    112304255 (PLCB1)
   04022 cGMP-PKG signaling pathway
    112304255 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112304255 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112304255 (PLCB1)
   04613 Neutrophil extracellular trap formation
    112304255 (PLCB1)
   04621 NOD-like receptor signaling pathway
    112304255 (PLCB1)
   04062 Chemokine signaling pathway
    112304255 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    112304255 (PLCB1)
   04922 Glucagon signaling pathway
    112304255 (PLCB1)
   04929 GnRH secretion
    112304255 (PLCB1)
   04912 GnRH signaling pathway
    112304255 (PLCB1)
   04915 Estrogen signaling pathway
    112304255 (PLCB1)
   04921 Oxytocin signaling pathway
    112304255 (PLCB1)
   04926 Relaxin signaling pathway
    112304255 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    112304255 (PLCB1)
   04918 Thyroid hormone synthesis
    112304255 (PLCB1)
   04919 Thyroid hormone signaling pathway
    112304255 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    112304255 (PLCB1)
   04916 Melanogenesis
    112304255 (PLCB1)
   04924 Renin secretion
    112304255 (PLCB1)
   04925 Aldosterone synthesis and secretion
    112304255 (PLCB1)
   04927 Cortisol synthesis and secretion
    112304255 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112304255 (PLCB1)
   04270 Vascular smooth muscle contraction
    112304255 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    112304255 (PLCB1)
   04971 Gastric acid secretion
    112304255 (PLCB1)
   04972 Pancreatic secretion
    112304255 (PLCB1)
   04973 Carbohydrate digestion and absorption
    112304255 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    112304255 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    112304255 (PLCB1)
   04725 Cholinergic synapse
    112304255 (PLCB1)
   04728 Dopaminergic synapse
    112304255 (PLCB1)
   04726 Serotonergic synapse
    112304255 (PLCB1)
   04720 Long-term potentiation
    112304255 (PLCB1)
   04730 Long-term depression
    112304255 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    112304255 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    112304255 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    112304255 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112304255 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112304255 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112304255 (PLCB1)
   05016 Huntington disease
    112304255 (PLCB1)
   05017 Spinocerebellar ataxia
    112304255 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    112304255 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112304255 (PLCB1)
   04934 Cushing syndrome
    112304255 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112304255 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112304255 (PLCB1)
   05142 Chagas disease
    112304255 (PLCB1)
   05143 African trypanosomiasis
    112304255 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112304255 (PLCB1)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112304255 (PLCB1)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112304255 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112304255 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 112304255
NCBI-ProteinID: XP_024415681
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRSDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISYLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRMFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQLMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFETSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKVISGQFLSDKKVGTYVEVDMFGLPVDTRRKALKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPSSLASDPGKLNHRPPSS
EELGGDHPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcatgctttgcaactcaagcccgtgtgtgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactattgtcactcca
attattttgaggtctgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctgttagatctcagccttgtcaaggatgccagatgtgggaaacacgccaaagct
cccaaggaccccaaattacgtgaacttctggatgtggggaacatcggacgtctggaacat
cgcatgataacggtggtgtatggacctgacttagttaacatctcctatttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgtatgttttcagca
gatcggaaacgagtcgaaactgctttagaggcttgcagtcttccatcctcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttccgaatttggtgccaaaagcaaaccttacctt
accgttgatcagctgatggattttatcaatcttaagcagcgagatccccggctaaatgaa
atactttacccacctttaaagcaagagcaagtccaagtgttgattgagaagtatgaaccc
aacaacagcctcgccaaaaaaggacagatctcagtggatggatttatgcgctatctgagt
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaacgaagatatgtctcag
ccactttctcactatttcattaattcctcgcacaacacctacctcacagctggccagctg
gctggaaactcctccgttgagatgtatcgtcaagtactcctgtctggttgtcgctgtgtg
gagctggactgctggaaaggacggaccgcagaagaggaaccagtcatcacccatgggttc
accatgacgactgaaatatccttcaaggaagtgatagaagcaatcgctgagtgtgcattt
aagacttcaccttttccaattctcctttcatttgagaatcatgtggattccccgaagcag
caagcgaagatggcggagtactgccggctgatcttcggggatgcccttctcatggagcca
ctggaaaaataccccctggaatctggagttcctcttccaagccctatggatttaatgtac
aaaattttagtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcggaacaagcttccaacacatacagcgactcctccagcgtgtttgaaccctcg
tcgcctggagctggggaagctgatacggagagtgacgacgacgatgatgacgatgactgt
aaaaagtcttcaatggatgaggggaccgcagggagtgaggccatggccacagaagagatg
tctaacctggtgaactacattcagccggtcaagtttgagtcatttgaaacttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgagcagctgacg
aagtctccggtggaattcgtagaatataacaaaatgcagcttagcaggatctatccaaaa
ggaacacgagtagattcatccaactatatgccgcagcttttctggaacgcaggttgccaa
atggttgccctgaatttccaaacagtagacctggctatgcagataaacatggggatgtat
gagtataatgggaagagtggctacagactaaagccagagtttatgaggagacctgacaag
cattttgatccattcaccgaaggcatcgtcgacggcatagtggccaacactttgtctgtt
aaggttatttcgggccagtttctttccgataagaaagtcgggacctatgtggaagtggat
atgtttggtctgcctgtggacacaaggaggaaagcgttgaagaccaagacttcacaagga
aatgctgtaaaccctgtctgggaagaagagcccattgtgttcaaaaaggtggttcttcct
tcactggcctgcctgaggatagcagtttatgaagaaggaggtaaatttattggtcacagg
atcctgccagtgcaagcaattcggccaggctatcactacatctgtctgaggaatgagagg
aaccaaccgctgatgctcccagctctctttgtctacatagaggtgaaagactacgtccca
gacacatatgcagatgtgattgaagctttgtcaaatccaattcgatatgtgaatctgatg
gagcagagagctaagcaactggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggccgatcctggggaaacaccgtcagaggcgccaagtgaagccaggacgactccagca
gaaaatggagtgaatcacactacatccctggcacccaaaccaccctcccaggctctccac
agccagcctgctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagc
gttttaacagaagtggaagctcagactattgaagagctaaagcaacagaaatcatttgta
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactacaaaatataatgaaattcagaatgactactta
agaaggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcagagccc
agcagccctgaccacggctcatcagccattgagcaggaccttgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggataaacaacaacagcaactgcttaatcttcga
caagaacagtattatagtgaaaaataccagaagcgtgaacatattaaactgcttattcag
aaattgacggatgttgctgaagaatgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagagaaaaaggaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaagaggaaaagacagagatgatccgg
tcatacattcaggaagtggtgcagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaactcgtagagaaacacaaggagatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaatatcaagacaagttcaaaagactgcccctggag
attttggagttcgtacaggaagccatgaaagggaagatcagtgaggacagcaatcacagt
tctgccccttcctccctggcctcggaccctgggaaactgaaccataggcccccctccagc
gaggagctgggaggagaccacccaggaaaagagtttgatactcctctgtga

KEGG   Desmodus rotundus (common vampire bat): 112311437
Entry
112311437         CDS       T05907                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04062  Chemokine signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04310  Wnt signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04621  NOD-like receptor signaling pathway
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04728  Dopaminergic synapse
dro04730  Long-term depression
dro04742  Taste transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05022  Pathways of neurodegeneration - multiple diseases
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05146  Amoebiasis
dro05163  Human cytomegalovirus infection
dro05200  Pathways in cancer
Module
dro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112311437 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112311437 (PLCB2)
   04310 Wnt signaling pathway
    112311437 (PLCB2)
   04371 Apelin signaling pathway
    112311437 (PLCB2)
   04020 Calcium signaling pathway
    112311437 (PLCB2)
   04070 Phosphatidylinositol signaling system
    112311437 (PLCB2)
   04072 Phospholipase D signaling pathway
    112311437 (PLCB2)
   04071 Sphingolipid signaling pathway
    112311437 (PLCB2)
   04022 cGMP-PKG signaling pathway
    112311437 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112311437 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112311437 (PLCB2)
   04613 Neutrophil extracellular trap formation
    112311437 (PLCB2)
   04621 NOD-like receptor signaling pathway
    112311437 (PLCB2)
   04062 Chemokine signaling pathway
    112311437 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    112311437 (PLCB2)
   04922 Glucagon signaling pathway
    112311437 (PLCB2)
   04929 GnRH secretion
    112311437 (PLCB2)
   04912 GnRH signaling pathway
    112311437 (PLCB2)
   04915 Estrogen signaling pathway
    112311437 (PLCB2)
   04921 Oxytocin signaling pathway
    112311437 (PLCB2)
   04926 Relaxin signaling pathway
    112311437 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    112311437 (PLCB2)
   04918 Thyroid hormone synthesis
    112311437 (PLCB2)
   04919 Thyroid hormone signaling pathway
    112311437 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    112311437 (PLCB2)
   04916 Melanogenesis
    112311437 (PLCB2)
   04924 Renin secretion
    112311437 (PLCB2)
   04925 Aldosterone synthesis and secretion
    112311437 (PLCB2)
   04927 Cortisol synthesis and secretion
    112311437 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112311437 (PLCB2)
   04270 Vascular smooth muscle contraction
    112311437 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    112311437 (PLCB2)
   04971 Gastric acid secretion
    112311437 (PLCB2)
   04972 Pancreatic secretion
    112311437 (PLCB2)
   04973 Carbohydrate digestion and absorption
    112311437 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    112311437 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    112311437 (PLCB2)
   04725 Cholinergic synapse
    112311437 (PLCB2)
   04728 Dopaminergic synapse
    112311437 (PLCB2)
   04726 Serotonergic synapse
    112311437 (PLCB2)
   04720 Long-term potentiation
    112311437 (PLCB2)
   04730 Long-term depression
    112311437 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    112311437 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    112311437 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    112311437 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112311437 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112311437 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112311437 (PLCB2)
   05016 Huntington disease
    112311437 (PLCB2)
   05017 Spinocerebellar ataxia
    112311437 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    112311437 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112311437 (PLCB2)
   04934 Cushing syndrome
    112311437 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112311437 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112311437 (PLCB2)
   05142 Chagas disease
    112311437 (PLCB2)
   05143 African trypanosomiasis
    112311437 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112311437 (PLCB2)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112311437 (PLCB2)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112311437 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112311437 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 Gp58
Other DBs
NCBI-GeneID: 112311437
NCBI-ProteinID: XP_024423561
LinkDB
Position
Unknown
AA seq 1201 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALVKHPLTANAPRTTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSACHLAKGKNDAINPEDFPESVYKSFLMNLCPRPEIDEIFTSYHAKAKPYMTKDH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKPPEEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGDTLLTEPLEKFPLKPGTPLPSPEDLRGKILIKNKKNQFSGPASPSKEPDGE
AEGSFPPIAPVAGDTGESAWQKWGWDGVGVREHLEQERGQEEEEVEDEEEEESGNLDEEE
IKKMQSDEGTAGLEVTAYEEMSSLVNYIQPTKFISFEFSAQRNRSYVISSFTELKAYDLL
SKAAVQFVDYNKRQMSRIYPKGTRMDSSNYLPQMFWNAGCQMVALNFQTMDLPMQQNMAL
FEFNGQTGYLLKHEFMRRPDKQFNPFSVDRIDVVVATTLSIKVISGQFLSERSVRTYVEV
ELFGLPGDPKRRYRTKLSPTTNSINPVWNEEPFVFEKILMPELASLRVAVLEEGNKCLGH
RIVPINALNSGYHHLCLRSESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSA
HDKKSVKLKEAMGGLPEKPFSLGSPVANQANGATARTSNGSAAAGASAREETTKEAVEPR
TTSLEELRELKGVVKLQRRHEKELRELERRGARRWEELLQRGAAQLAELGLPGAGSSCGG
RRLGPGKGSRKKRTLPCEETAGATEGEGPEGADMRVRELRDQLELGLLQQGEEKYECILK
RKQQQVAEQISKMTELAKEKQAAELKTLKETSESDTKEMKKKLEAKRLERIQAMVKVTTD
KMAQERLKREINNSHIQEVVQVIKQMTESLERHQEKLEEKQAACLEQIREMEKQLQQEAL
AEYEARMKGLEAEVKESVRTCLRACFPSEAEDKLERPCGVSRELCGPDPLKAKEDTQESF
L
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcttatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaacaacaatagcctccccggttatcctccgtgtg
gaccccaagggctattacttatactggacgtatcagagtaaggagatggagtttctggat
atcaccagcatccgggacacccgctttgggaagtttgccaagattcccaagagccagaag
ctccgggacgtcttcaacatggacttccctgacaacaacttcctgctgaagacactcacg
gtggtgtccggccctgacatggtggaccttaccttccacaacttcgtctcctacaaggag
aatgtgggcaaggactgggctgaagatgtcctggccctggtcaagcacccgctgacagcc
aacgccccccgcaccaccttcctagacaagatcctggtgaagctcaaaatgcagctcaat
cctgaagggaagattcctgtgaagaattttttccagatgttccctgctgaccgcaagcgg
gtagaagctgccctcagtgcctgccaccttgccaaaggcaaaaatgacgccatcaatccc
gaggacttcccagaatctgtctacaagagtttcctcatgaacctctgccctcggccagaa
atagatgagatcttcacttcctaccatgccaaggccaaaccctacatgaccaaggatcac
ctgaccaaattcatcaaccagaaacagagggactcccgcctcaactccttactgttccca
cccgcacggcccgaccaggtgcagggcctcatcgacaagtacgagcccagcggcatcaac
gtgcagagggggcagctgtcaccggagggcatggtgtggtttctctgtgggccggagaac
agcgtgctggcccaggacaagctgctgcttcaccacgacatgacacagccactcaaccat
tacttcatcaactcctcacacaacacctacctgacagctggccagttctcaggcctttcc
tccgccgagatgtaccgccaggtactgctggctggctgccgctgtgtggagctggactgc
tggaaggggaagccccccgaagaggagccgatcatcacccatggctttaccatgaccaca
gacatctacttcaaagaagcaattgaagcaattgcagaaagtgcctttaagacctccccg
tatcctgtcatcctgtcatttgagaaccacgtggattcaccccgccaacaggccaagatg
gccgagtactgccggacgatgtttggcgacacgctgctcacagagcccctggaaaagttt
ccgttgaaaccaggcacccccctgcccagccctgaggatctgcgtggcaagatcctcatt
aagaacaagaagaatcagttttctggcccagcatcccccagcaaggagcccgatggggaa
gctgagggcagcttcccgcccattgcccctgtggctggggacacaggtgagtcagcctgg
cagaaatgggggtgggatggggtgggggtgagggagcatctggaacaggagagagggcaa
gaggaggaggaggtggaagatgaagaggaggaggagtcgggaaacctggatgaagaagag
ataaagaagatgcaatcagatgagggcacagcgggcctggaagtgacagcttacgaggag
atgtccagcctagtcaactacatccagcccaccaagttcatctcctttgagttctctgcc
cagaggaaccgaagttatgtcatctcctccttcacggagctcaaggcttatgacctgctt
tccaaggctgcagtgcaatttgtggactacaacaagcgccagatgagccgcatctacccc
aagggcacccgcatggactcctccaactacctgccccagatgttctggaatgctggctgc
cagatggttgccctcaacttccagacgatggacctgcccatgcagcagaacatggcacta
tttgagttcaatgggcagaccggctacctcctcaaacatgagttcatgcgtcggccagac
aagcagttcaacccgttctcggtggaccgcatcgacgtagtggtagccaccaccctgtcc
attaaggtcatctccgggcagttcctgtcagaacgcagcgtgcgcacctacgtggaagtg
gagctattcggccttcctggggaccccaagaggcgctatcgcaccaagctgtcacccact
accaactctatcaaccctgtctggaatgaggagccctttgtctttgagaagatcttgatg
cctgagctggcctccctcagggtggccgtgctggaggaaggcaacaagtgtcttggacac
cgcatcgtccccatcaatgccctcaattctggataccaccatctgtgcctgcgcagcgag
agcaacatgcccctcaccatgccagcgctcttcgtcttcctggagatgaaggactatgta
cctgacacctgggcagatctcactgtggccctcgccaaccccatcaagttcttcagtgcc
catgacaagaagtctgtgaagctcaaggaagccatgggaggtctgcctgagaagcccttc
tcccttgggagtccagttgccaaccaggccaacggagcaactgcccggaccagcaatggg
tcagcggcagccggggccagtgccagggaggagaccacgaaagaagctgtggagccccgg
accaccagtctggaggagctgcgggagctgaagggcgtcgtgaagctgcagcggcggcac
gagaaggagctgcgggagctggagcggcgtggcgcacggcgctgggaggagctgctgcag
cggggtgctgcgcagctggcagagcttgggctgccgggcgcggggagcagctgcgggggc
cgcaggctgggcccaggcaagggctcccgcaagaaaaggaccctgccctgcgaggagacc
gctggggccacagagggcgagggtcccgagggcgcggatatgcgcgtgcgtgagctgagg
gaccagctggagctggggctgctgcagcagggcgaggagaagtatgagtgcatcctgaag
cgcaagcagcagcaagtggcggagcaaatctccaagatgacggagctggccaaagagaaa
caggctgcagagcttaagaccctcaaggagacctcggagagtgacaccaaagagatgaag
aagaagctggaggccaagaggctagagcggatccaggccatggtcaaggtcaccactgac
aagatggcccaggagcgattgaaaagagagattaacaactcccacatccaagaggtggta
caggtcatcaagcagatgacagagagcctggagaggcaccaggagaagctggaggagaag
caggcagcctgcctggaacagatccgggagatggaaaagcagttgcagcaggaggcgctg
gcagagtacgaggccaggatgaagggcctggaggccgaggtgaaggaatcagtgaggacc
tgcctcagggcctgcttcccctctgaggctgaggacaagcttgagaggccctgtggggtc
tccagggagctgtgtgggccggacccacttaaagccaaggaagatacccaggaaagcttc
ctctga

KEGG   Desmodus rotundus (common vampire bat): 112317151
Entry
112317151         CDS       T05907                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00562  Inositol phosphate metabolism
dro01100  Metabolic pathways
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04062  Chemokine signaling pathway
dro04070  Phosphatidylinositol signaling system
dro04071  Sphingolipid signaling pathway
dro04072  Phospholipase D signaling pathway
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04310  Wnt signaling pathway
dro04371  Apelin signaling pathway
dro04540  Gap junction
dro04611  Platelet activation
dro04613  Neutrophil extracellular trap formation
dro04621  NOD-like receptor signaling pathway
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04728  Dopaminergic synapse
dro04730  Long-term depression
dro04742  Taste transduction
dro04750  Inflammatory mediator regulation of TRP channels
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04916  Melanogenesis
dro04918  Thyroid hormone synthesis
dro04919  Thyroid hormone signaling pathway
dro04921  Oxytocin signaling pathway
dro04922  Glucagon signaling pathway
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04926  Relaxin signaling pathway
dro04927  Cortisol synthesis and secretion
dro04928  Parathyroid hormone synthesis, secretion and action
dro04929  GnRH secretion
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro04961  Endocrine and other factor-regulated calcium reabsorption
dro04970  Salivary secretion
dro04971  Gastric acid secretion
dro04972  Pancreatic secretion
dro04973  Carbohydrate digestion and absorption
dro05010  Alzheimer disease
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05022  Pathways of neurodegeneration - multiple diseases
dro05142  Chagas disease
dro05143  African trypanosomiasis
dro05146  Amoebiasis
dro05163  Human cytomegalovirus infection
dro05200  Pathways in cancer
Module
dro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112317151 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112317151 (PLCB3)
   04310 Wnt signaling pathway
    112317151 (PLCB3)
   04371 Apelin signaling pathway
    112317151 (PLCB3)
   04020 Calcium signaling pathway
    112317151 (PLCB3)
   04070 Phosphatidylinositol signaling system
    112317151 (PLCB3)
   04072 Phospholipase D signaling pathway
    112317151 (PLCB3)
   04071 Sphingolipid signaling pathway
    112317151 (PLCB3)
   04022 cGMP-PKG signaling pathway
    112317151 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112317151 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112317151 (PLCB3)
   04613 Neutrophil extracellular trap formation
    112317151 (PLCB3)
   04621 NOD-like receptor signaling pathway
    112317151 (PLCB3)
   04062 Chemokine signaling pathway
    112317151 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    112317151 (PLCB3)
   04922 Glucagon signaling pathway
    112317151 (PLCB3)
   04929 GnRH secretion
    112317151 (PLCB3)
   04912 GnRH signaling pathway
    112317151 (PLCB3)
   04915 Estrogen signaling pathway
    112317151 (PLCB3)
   04921 Oxytocin signaling pathway
    112317151 (PLCB3)
   04926 Relaxin signaling pathway
    112317151 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    112317151 (PLCB3)
   04918 Thyroid hormone synthesis
    112317151 (PLCB3)
   04919 Thyroid hormone signaling pathway
    112317151 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    112317151 (PLCB3)
   04916 Melanogenesis
    112317151 (PLCB3)
   04924 Renin secretion
    112317151 (PLCB3)
   04925 Aldosterone synthesis and secretion
    112317151 (PLCB3)
   04927 Cortisol synthesis and secretion
    112317151 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112317151 (PLCB3)
   04270 Vascular smooth muscle contraction
    112317151 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    112317151 (PLCB3)
   04971 Gastric acid secretion
    112317151 (PLCB3)
   04972 Pancreatic secretion
    112317151 (PLCB3)
   04973 Carbohydrate digestion and absorption
    112317151 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    112317151 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    112317151 (PLCB3)
   04725 Cholinergic synapse
    112317151 (PLCB3)
   04728 Dopaminergic synapse
    112317151 (PLCB3)
   04726 Serotonergic synapse
    112317151 (PLCB3)
   04720 Long-term potentiation
    112317151 (PLCB3)
   04730 Long-term depression
    112317151 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    112317151 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    112317151 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    112317151 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112317151 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112317151 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112317151 (PLCB3)
   05016 Huntington disease
    112317151 (PLCB3)
   05017 Spinocerebellar ataxia
    112317151 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    112317151 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112317151 (PLCB3)
   04934 Cushing syndrome
    112317151 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112317151 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112317151 (PLCB3)
   05142 Chagas disease
    112317151 (PLCB3)
   05143 African trypanosomiasis
    112317151 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dro04131]
    112317151 (PLCB3)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112317151 (PLCB3)
Membrane trafficking [BR:dro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112317151 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112317151 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y PH_14 EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 112317151
NCBI-ProteinID: XP_024429950
LinkDB
Position
Unknown
AA seq 1164 aa
MEVDTLDISSIRDTRTGRYARPPRDPKIREVLGFGGPEARLEEKLMTVVAGPDPVNTTFL
NFMAVQDDTAKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKM
FSADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGK
PYLTLEQLMEFINQKQRDPRLNEVLYPPLGTSQTRLLIEKYEPNQQFLERDQMSMEGFSR
YLGGEENGILPLETLDLSSDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGC
RCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAESAFKTSPYPVILSFENHVDS
AKQQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSTGIP
NSSVRKRPLEQSNSVLSESSAATEPSSPQLGSPSSDSCPGLSNGEEAGLEKPSLEPQKSL
GDLGPADREDEEEDEEEEEQTDPKKATTDEGTASSEVNATEEMSTLVNYVEPVKFKSFEA
ARKRKKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNV
GCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVDGIVANA
LRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRGKYRTRTSQGNSFNPVWDEEPFEFPKV
VLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIYTEASD
YIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGEREAQAGPETCQETQSSQLGSQLTP
NPTPSPLDTTPRRPPGPVTSPTSPSLSSPGQRDDLIASILSEVVVAPLEELRGHKALVKL
RSRQERDLREMLKKHQRKAVALTRRLLDNLAQARAEGRCRHRPGVLGGEDEKEEEEEAKR
YQEFQNRQVQSLLELREAQADAEAERRLEHLRQALQRLREIVLEAHTTQVKRLKEMNDRE
KKELQKILDRKRHNSISEAKTREKHKKEVELTEINRRHITESVNSIRRLEEAQKQRHERV
MAGQQQVLQQLVEDEPKLLGQLAQECQEQRARLPQEIRRSLLGETPEGLGDGHLVACASN
GHAPGSIGHLCGADSESQEENTKL
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggaggtggacacgctggacatcagttccattagggacacacggacaggccgctacgcc
cgcccgcccagggaccccaaaatccgtgaggtgctgggttttgggggccctgaagcccgg
ctagaagagaagctgatgacggtggtggccgggccagacccagttaacacaacgttcctg
aacttcatggccgtgcaggatgacacagccaaggtctgggctgaggagctgttcaagttg
gctatgaacatcttggctcagaatgcctccaggaacaccttcctgcgcaaagcatataca
aagctgaagctgcaggtgaaccaggatggacggatcccggtcaagaacatcctgaagatg
ttctcagcagacaagaagcgggtagagactgcgctggagtcctgtggcctcaattttaac
cggagcgagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaac
aagttgtgtctccggccagacattgacaagatcctgctggagataggtgccaagggcaag
ccgtacctgacgctagagcagctcatggaattcatcaaccagaagcaacgggacccaaga
ctcaatgaagtgctgtacccacccttggggacctcccagacccggctgctcattgagaag
tatgagcccaaccagcagttcctggagcgagaccagatgtccatggagggcttcagccgc
tacctgggcggggaggagaatggcatcctgcccctagaaaccctggatctgagctcagac
atgacccagccgctgagcgcctacttcatcaactcctcacataacacctatctgacagcg
gggcagctggctgggacctcgtcggtggagatgtaccgccaggctctgctgtggggctgc
cgctgtgtggagctggacgtgtggaaagggcggccgccggaggaggagcccttcatcacc
catggcttcaccatgaccacggaggtgccgctgcgggatgtgctcgaggccattgctgag
agcgccttcaaaacctcaccctacccggtcatcctctccttcgagaaccatgtggactcg
gcaaagcaacaggccaagatggctgagtactgccgctccatctttggggatgcgctgctc
atcgacccactggacaagtacccgctggccccgggcgtccccttgcccagcccccaggat
ctgatgggccgcatcctggtgaagaacaagaagcggcaccggcccagcactggcatcccc
aacagctccgtgcgcaaacggccactggagcagagcaactcggtcctgagcgagagctct
gccgccacggagccctcctcgccccagctcgggtcccccagctctgacagctgcccaggc
ctgagcaatggggaggaggcaggccttgagaagcccagcctggagccacagaagtctctg
ggcgatcttggacctgctgaccgtgaggatgaggaggaggatgaagaagaggaggaacag
acggaccccaaaaaggcgaccacggatgagggcaccgctagcagtgaggtcaatgctact
gaggaaatgtcgaccctcgtcaactacgtcgagcctgtgaagttcaaatccttcgaggct
gctcgaaagaggaaaaagtgcttcgagatgtcatcctttgtggagaccaaggccatggaa
cagctgaccaagagccccatggagtttgtggaatacaacaaacagcagctcagccgcatc
taccccaagggcacccgtgtggactcatccaactacatgccccagctcttctggaacgtg
ggctgccagctcgtggcactcaacttccagaccttggatgtggcgatgcagctcaacgca
ggcgtgtttgagtacaacgggcgcagcggctacctgctcaagcctgagttcatgaggcgg
ccagacaagtcctttgatcccttcaccgaggtcatcgtggacggcattgtggccaatgcc
ttacgggtcaaggtgatctccgggcagttcctgtccgacaggaaggtgggcatctacgtg
gaggtggatatgttcggcctccccgtggacacgcggcgcggcaagtaccgaactcggacc
tctcaggggaactccttcaacccagtgtgggacgaagagccctttgagttccccaaggtg
gtgctgcccacgttggcttcgctgcgcattgcggcctttgaggagggtggcaagttcgtg
gggcaccggatcctgcctgtctctgccatccgctcagggtaccactacatctgcctaaga
aacgaggccaaccagcccctgtgcctgccggccctgctcatctacactgaggcctctgac
tacatccctgacgatcaccaggactatgcagaggccctgatcaaccccatcaagcacgtc
agcctgatggaccagagggccaagcagctggctgccctcattggggagagagaggctcag
gctggcccggagacatgccaggagacccagtcttcgcagctggggtcccagctgacccca
aaccccacacccagcccactggacaccaccccccgccggcccccaggccctgtcacctcc
cccaccagcccttcccttagcagcccaggtcagcgggatgacctcattgccagtattctg
tcagaggtggttgtggccccactggaggagctccgaggccacaaggctctggtgaagctc
cggagtcgacaagagcgagacctgcgggagatgctcaagaagcatcaacggaaggcggtt
gctctcactcgccgattgctggacaacctggcccaggcccgggccgagggcaggtgccgg
caccgaccaggtgtcctaggcggggaggacgagaaggaggaggaggaagaggcgaagcgg
tatcaagagttccagaatagacaggtgcagagtctgctggagctgcgggaggcccaggcg
gacgctgaggccgagcggaggctggagcacttgagacaggctctgcagcggctcagggag
attgtcctggaggctcacacaactcaggtcaagaggctgaaggagatgaacgacagggag
aagaaggaactgcagaaaatcctggacaggaaacgccacaacagtatctcggaggccaag
acaagggagaaacataagaaggaagtggaactgacagagattaaccggcgccacatcacc
gagtccgtcaactccatccgtcggctggaggaggcccagaagcagcggcatgaacgggtt
atggctgggcagcagcaggtcctacagcagctggtggaagacgagcccaagctgctgggc
cagctggcccaggaatgccaggagcagcgggcgaggctgccccaggagatccgccggagc
ctgctgggcgagacgccggaggggctgggggatggacatctggtagcctgtgccagcaac
ggtcacgcgcctgggagcattgggcacctgtgtggcgctgactcggagagccaagaggag
aatacaaagctctga

DBGET integrated database retrieval system