KEGG   Desmodus rotundus (common vampire bat): 112305527
Entry
112305527         CDS       T05907                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro04114  Oocyte meiosis
dro04115  p53 signaling pathway
dro04218  Cellular senescence
dro04540  Gap junction
dro04914  Progesterone-mediated oocyte maturation
dro05170  Human immunodeficiency virus 1 infection
dro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112305527 (CDK1)
   04114 Oocyte meiosis
    112305527 (CDK1)
   04115 p53 signaling pathway
    112305527 (CDK1)
   04218 Cellular senescence
    112305527 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112305527 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    112305527 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112305527 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112305527 (CDK1)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112305527 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     112305527 (CDK1)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112305527 (CDK1)
DNA replication proteins [BR:dro03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    112305527 (CDK1)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112305527 (CDK1)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112305527 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 112305527
NCBI-ProteinID: XP_024417061
LinkDB
Position
Unknown
AA seq 297 aa
MEDYIKIEKIGEGTYGVVYKGKHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEYLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPDVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALNHPYFNDLDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagactatatcaaaatagagaaaattggagaaggcacctatggagttgtgtataag
ggtaaacacaaaaccacaggtcaagtggtagccatgaagaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatctctcttttaaaggaacttcgtcac
ccaaatatagtcagtcttcaagatgtgctcatgcaggattcaaggttatatctcatcttt
gaatacctttccatggatctaaagaaatacttggattctatccctcctggtcaattcatg
gattcttcacttgttaagagctatttgtaccagatcctacaagggattgtgttttgtcac
tctagaagagttctgcaccgcgacttaaaacctcaaaatctattgattgatgacaaagga
acaattaaactggctgattttggtcttgccagagcttttggaatacctattagagtatat
acacatgaggtagtaacactttggtatagatctccagaagtattgctcgggtcagctcgc
tattcgactccagttgacatttggagtataggcaccatatttgctgaattagcgactaag
aaaccacttttccatggagattcagaaattgatcagctcttcagaattttcagagctttg
ggtacccccaacaatgaagtgtggccagatgtggaatctttacaggactataagaataca
tttcccaaatggaaaccaggaagtctagcatcccatgtcaaaaacttggatgaaaatggc
ttggatctgctctcgaaaatgttagtctacgatcctgccaaacgaatttctggcaaaatg
gcactgaatcatccatattttaatgatttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system