KEGG   Desmodus rotundus (common vampire bat): 112306912
Entry
112306912         CDS       T05907                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04010  MAPK signaling pathway
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04015  Rap1 signaling pathway
dro04020  Calcium signaling pathway
dro04066  HIF-1 signaling pathway
dro04068  FoxO signaling pathway
dro04072  Phospholipase D signaling pathway
dro04144  Endocytosis
dro04151  PI3K-Akt signaling pathway
dro04510  Focal adhesion
dro04520  Adherens junction
dro04540  Gap junction
dro04630  JAK-STAT signaling pathway
dro04810  Regulation of actin cytoskeleton
dro04912  GnRH signaling pathway
dro04915  Estrogen signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04934  Cushing syndrome
dro05160  Hepatitis C
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05171  Coronavirus disease - COVID-19
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05218  Melanoma
dro05219  Bladder cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05231  Choline metabolism in cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112306912 (EGFR)
   04012 ErbB signaling pathway
    112306912 (EGFR)
   04014 Ras signaling pathway
    112306912 (EGFR)
   04015 Rap1 signaling pathway
    112306912 (EGFR)
   04630 JAK-STAT signaling pathway
    112306912 (EGFR)
   04066 HIF-1 signaling pathway
    112306912 (EGFR)
   04068 FoxO signaling pathway
    112306912 (EGFR)
   04020 Calcium signaling pathway
    112306912 (EGFR)
   04072 Phospholipase D signaling pathway
    112306912 (EGFR)
   04151 PI3K-Akt signaling pathway
    112306912 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112306912 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112306912 (EGFR)
   04520 Adherens junction
    112306912 (EGFR)
   04540 Gap junction
    112306912 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112306912 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112306912 (EGFR)
   04915 Estrogen signaling pathway
    112306912 (EGFR)
   04921 Oxytocin signaling pathway
    112306912 (EGFR)
   04926 Relaxin signaling pathway
    112306912 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    112306912 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112306912 (EGFR)
   05206 MicroRNAs in cancer
    112306912 (EGFR)
   05205 Proteoglycans in cancer
    112306912 (EGFR)
   05230 Central carbon metabolism in cancer
    112306912 (EGFR)
   05231 Choline metabolism in cancer
    112306912 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112306912 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112306912 (EGFR)
   05212 Pancreatic cancer
    112306912 (EGFR)
   05225 Hepatocellular carcinoma
    112306912 (EGFR)
   05226 Gastric cancer
    112306912 (EGFR)
   05214 Glioma
    112306912 (EGFR)
   05218 Melanoma
    112306912 (EGFR)
   05219 Bladder cancer
    112306912 (EGFR)
   05215 Prostate cancer
    112306912 (EGFR)
   05213 Endometrial cancer
    112306912 (EGFR)
   05224 Breast cancer
    112306912 (EGFR)
   05223 Non-small cell lung cancer
    112306912 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112306912 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112306912 (EGFR)
   05171 Coronavirus disease - COVID-19
    112306912 (EGFR)
   05163 Human cytomegalovirus infection
    112306912 (EGFR)
   05165 Human papillomavirus infection
    112306912 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112306912 (EGFR)
   01522 Endocrine resistance
    112306912 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112306912 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dro04147]
    112306912 (EGFR)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112306912 (EGFR)
Protein kinases [BR:dro01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112306912 (EGFR)
Exosome [BR:dro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112306912 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   112306912 (EGFR)
  Exosomal proteins of bladder cancer cells
   112306912 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr GF_recep_IV Pkinase Recep_L_domain Furin-like APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 112306912
NCBI-ProteinID: XP_024418711
LinkDB
Position
Unknown
AA seq 941 aa
MLYNPTTYQVDVNPDGKYSFGATCVKKCPRNYVVTDHGSCVRACGSDSYEVEEDGVRKCK
KCEGPCRKVCNGIGIGEFKDTLSINATNIKHFRNCTSISGDLHILPVAFKGDTFTHTQPL
DPKELDILKTVKEITGSLLIQAWPENRTDLHAFENLEIIRGRTKQHGRFSFAVVGLNITS
LGLRSLKEISDGDVVITGNRHLCYADTVNWKKLFGTSGQKTKVEKNKDRKDCRAQGHVCN
PLCSSEGCWGPGPRDCMSCRNVSRDKECVEKCNILEGEPREFEEKSECIRCHPECLPQPM
NVTCTGHGPDKCVQCAHYIDGPHCVSTCPEGVMGENSTLVWKFADAQHVCHLCHPNCTYG
CAGPGLEGCARGPKIPSIATGIVGGLLLVVVVALGIGLFLRRRHIVRKRTLRRLLQEREL
VEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELR
EATSPKANKEILDEAYVMASVDHPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDN
IGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKE
YHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISTVLE
KGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIHEFSKMARDPQRYLVIQGDERMH
LPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQAFFHSPSTSRTPLLSSLSATSNSSTVA
CADRNGQSCPLKEDSFLQRYSSDPTGALTEDVINGTFLPAPEYINQLVPKRPAGSVQNPV
YHNQPLNLAPGRDPHYQNPHSNAVGNPEYLNTTPPPTVNGVPDGPTLWVQKGSHQISLDN
PDYQQDFFPREAKSNGIFKGPTAENADYLRVGAPSSEFIGA
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgctgtacaaccccaccacgtaccaggtggacgtcaacccagatggaaaatacagcttt
ggagccacctgtgtgaagaaatgtccccgcaactacgtggtgaccgaccacgggtcgtgt
gtccgggcctgcggctcagacagctacgaggtggaggaagacggcgtccgcaagtgtaaa
aagtgtgaagggccctgtcgcaaagtctgcaatgggataggaatcggagagttcaaggac
accctctccatcaacgccacgaacatcaaacacttccggaactgcacgtccatcagcggg
gacctccacatcctgccggtcgctttcaagggggacaccttcacacacacgcaacctctg
gaccccaaggagctggacattctcaagaccgtaaaggagatcacagggtctctgctgatt
caggcctggccggaaaacaggacggacctccacgcattcgagaacctagagatcatacgc
ggcaggacgaagcagcacggccggttttctttcgcggtggtcgggctgaacatcacgtca
ctgggactgcgctcgctgaaggagatcagcgacggcgatgtggtcatcacaggaaaccgc
cacctgtgctacgcagacacagtgaactggaaaaagctctttgggacctcgggtcagaaa
acaaaggttgagaaaaacaaagacagaaaagactgccgggcccaaggccacgtctgcaac
ccgctgtgctcatctgaggggtgctggggcccggggccccgggactgcatgtcttgccga
aacgtcagccgagacaaggagtgcgtggagaaatgcaacattctcgagggcgagcccagg
gagttcgaggagaaatccgagtgcatacggtgccatccggagtgcctgccgcagcccatg
aacgtgacctgcacgggacacggaccggacaagtgcgtgcagtgtgcccactacatcgac
ggccctcactgtgtcagcacctgcccagagggggtcatgggcgaaaacagcacgctggtc
tggaagttcgcggacgcccagcacgtctgtcacctgtgccatccaaactgtacctacggc
tgtgcggggccgggccttgaaggctgcgcaagggggcccaagatcccgtccatcgccacg
gggattgtgggcggcctcctcttggtggtggtggtggccctcgggataggcctgtttctg
cgcaggcgccacatcgtccggaagcgcacgctgcggaggctgctgcaggagcgggagctc
gtggagccccttacacccagcggagaagcacccaaccaagctctcctgcggatcttaaag
gagacagaattcaaaaaaatcaaggtgctgggctccggcgcgtttggcaccgtgtacaag
gggctctggatccccgagggcgagaaggtcaaaatccccgtggccatcaaggaattgaga
gaagccacgtctccgaaagccaacaaggagattctcgatgaagcctacgtgatggccagc
gtggaccacccccatgtgtgccgcctgctgggcatctgcctgacctccacggtgcagctc
atcacccagctcatgcccttcggctgcctgctggactacgtccgcgagcacaaggacaac
atcggctcccagtacctgctcaactggtgtgtgcagatcgccaagggcatgaactacctg
gaggaccggcgcctggtgcaccgggacctggcggccaggaatgtcctggtgaagacaccg
cagcacgtcaagatcaccgacttcgggctggccaaactgctgggcgcggaggagaaagag
taccacgcagaggggggcaaagtgcccatcaagtggatggctttggagtctattttacac
cgaatttatacccaccaaagtgacgtctggagctatggggtcaccgtttgggagctgatg
acctttgggtccaagccttacgacgggatcccggcgagtgagatctccaccgtcctggag
aaaggagagcgcctcccgcagccgcccatctgcaccattgacgtctacatgatcatggtc
aagtgctggatgatagacgcagacagccgcccgaagttccgggagctgatccatgaattc
tccaagatggcccgggacccccagcgctaccttgtcatccagggggatgagagaatgcac
ctgcccagccctaccgactccaacttctaccgcgccctgatggacgaagaggacatggag
gacgttgtcgacgccgacgagtacctcatcccccagcaggccttcttccacagcccctcc
acctcccggacgccccttctgagctccctgagcgccaccagcaacagctccactgtggcg
tgcgctgacagaaacgggcagagctgccccctgaaggaagacagcttcttgcagcggtac
agctccgaccccaccggggccttgaccgaggacgtcatcaacggcactttcctcccagcg
ccagaatacataaaccagttggttcccaaaaggccggcgggctccgtccagaaccccgtc
taccacaatcaacccctaaacctggctccaggccgagaccctcactaccagaacccccac
agcaacgccgtgggcaaccccgagtatctcaacaccacccctcctcccaccgtcaacggc
gtccccgatggccccaccctctgggtgcagaaaggcagccaccagattagcctggacaac
cccgactaccaacaggacttcttccccagggaagccaagtccaatggcatctttaagggg
ccgacagctgaaaatgcagactacctgagggtaggcgccccgagcagtgaatttatcgga
gcatga

DBGET integrated database retrieval system