KEGG   Desmodus rotundus (common vampire bat): 112306993
Entry
112306993         CDS       T05907                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04932  Non-alcoholic fatty liver disease
dro05010  Alzheimer disease
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05134  Legionellosis
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05222  Small cell lung cancer
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112306993
   04215 Apoptosis - multiple species
    112306993
   04115 p53 signaling pathway
    112306993
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112306993
  09162 Cancer: specific types
   05210 Colorectal cancer
    112306993
   05222 Small cell lung cancer
    112306993
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112306993
   05012 Parkinson disease
    112306993
   05014 Amyotrophic lateral sclerosis
    112306993
   05016 Huntington disease
    112306993
   05017 Spinocerebellar ataxia
    112306993
   05020 Prion disease
    112306993
   05022 Pathways of neurodegeneration - multiple diseases
    112306993
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112306993
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112306993
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112306993
   05134 Legionellosis
    112306993
   05152 Tuberculosis
    112306993
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112306993
   05161 Hepatitis B
    112306993
   05160 Hepatitis C
    112306993
   05164 Influenza A
    112306993
   05162 Measles
    112306993
   05168 Herpes simplex virus 1 infection
    112306993
   05163 Human cytomegalovirus infection
    112306993
   05167 Kaposi sarcoma-associated herpesvirus infection
    112306993
   05169 Epstein-Barr virus infection
    112306993
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112306993
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112306993
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112306993
NCBI-ProteinID: XP_024418861
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEATLMEYLENPKKYIPGTKMIFAGIKKSSERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
acgggtcaggcccctggtttttcttacacggatgccaacaagaataaagggatcacctgg
ggagaggctacactgatggagtatttggagaaccccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagagttcagaaagggcagatttgatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Desmodus rotundus (common vampire bat): 112320658
Entry
112320658         CDS       T05907                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04932  Non-alcoholic fatty liver disease
dro05010  Alzheimer disease
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05134  Legionellosis
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05222  Small cell lung cancer
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112320658
   04215 Apoptosis - multiple species
    112320658
   04115 p53 signaling pathway
    112320658
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112320658
  09162 Cancer: specific types
   05210 Colorectal cancer
    112320658
   05222 Small cell lung cancer
    112320658
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112320658
   05012 Parkinson disease
    112320658
   05014 Amyotrophic lateral sclerosis
    112320658
   05016 Huntington disease
    112320658
   05017 Spinocerebellar ataxia
    112320658
   05020 Prion disease
    112320658
   05022 Pathways of neurodegeneration - multiple diseases
    112320658
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112320658
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112320658
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112320658
   05134 Legionellosis
    112320658
   05152 Tuberculosis
    112320658
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112320658
   05161 Hepatitis B
    112320658
   05160 Hepatitis C
    112320658
   05164 Influenza A
    112320658
   05162 Measles
    112320658
   05168 Herpes simplex virus 1 infection
    112320658
   05163 Human cytomegalovirus infection
    112320658
   05167 Kaposi sarcoma-associated herpesvirus infection
    112320658
   05169 Epstein-Barr virus infection
    112320658
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112320658
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112320658
SSDB
Motif
Pfam: Cytochrom_C
Other DBs
NCBI-GeneID: 112320658
NCBI-ProteinID: XP_024433941
LinkDB
Position
Unknown
AA seq 105 aa
MGDLEEVKRVAVQKGAHCHTMEWGGKHKTEPSLHGLFAQKTSQTPGFSYTDANKNKGITW
REATLREYLENPNKPIPGTKLAFAGSKKSSERADFIAYLKKATTE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatcttgaggaggtcaagagggttgctgttcagaagggtgcccactgccacacc
atggaatggggaggcaagcacaagactgaacccagcctccatggtctttttgcgcaaaag
acaagtcagacccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
agagaggctacactgagggagtatttggagaatcccaacaagcccatccctggaacaaaa
ctggcctttgcaggcagtaagaagagttcagaaagggcagattttatagcttatctcaaa
aaagctactactgagtaa

KEGG   Desmodus rotundus (common vampire bat): 112322221
Entry
112322221         CDS       T05907                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04215  Apoptosis - multiple species
dro04932  Non-alcoholic fatty liver disease
dro05010  Alzheimer disease
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05017  Spinocerebellar ataxia
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05132  Salmonella infection
dro05134  Legionellosis
dro05145  Toxoplasmosis
dro05152  Tuberculosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05222  Small cell lung cancer
dro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112322221
   04215 Apoptosis - multiple species
    112322221
   04115 p53 signaling pathway
    112322221
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322221
  09162 Cancer: specific types
   05210 Colorectal cancer
    112322221
   05222 Small cell lung cancer
    112322221
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112322221
   05012 Parkinson disease
    112322221
   05014 Amyotrophic lateral sclerosis
    112322221
   05016 Huntington disease
    112322221
   05017 Spinocerebellar ataxia
    112322221
   05020 Prion disease
    112322221
   05022 Pathways of neurodegeneration - multiple diseases
    112322221
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112322221
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112322221
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112322221
   05134 Legionellosis
    112322221
   05152 Tuberculosis
    112322221
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112322221
   05161 Hepatitis B
    112322221
   05160 Hepatitis C
    112322221
   05164 Influenza A
    112322221
   05162 Measles
    112322221
   05168 Herpes simplex virus 1 infection
    112322221
   05163 Human cytomegalovirus infection
    112322221
   05167 Kaposi sarcoma-associated herpesvirus infection
    112322221
   05169 Epstein-Barr virus infection
    112322221
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112322221
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112322221
SSDB
Motif
Pfam: Cytochrom_C Cytochrom_C550 Cytochrome_CBB3
Other DBs
NCBI-GeneID: 112322221
NCBI-ProteinID: XP_024435597
LinkDB
Position
Unknown
AA seq 139 aa
MAQYFDISNRKKIKNISGTHSPLSPDQFQQSDFKIGDVEKGKKIFVQKCAQCHIVEKGGK
CKIGPNLHGLFGQKAGEAPGFSYLDINKNKGIIWGEATVMEYLGNPKKYIPETKMIFAGI
KKILERKDLIAYLKEATNE
NT seq 420 nt   +upstreamnt  +downstreamnt
atggcacagtacttcgatatttcaaacaggaagaaaataaaaaatatctctggcactcat
tcacctctttctcctgatcagtttcaacagagtgattttaaaatcggtgatgttgagaaa
ggcaagaagatttttgttcagaagtgtgcccagtgccatattgtggaaaaaggaggcaag
tgcaagattgggccaaatctccatggtttatttgggcaaaaggcaggtgaggcccctgga
ttttcttacttggatatcaacaagaacaaaggcatcatctggggagaggctacagtgatg
gagtatttgggaaatcccaagaagtatatccctgaaacaaaaatgatctttgctggcatt
aagaagattttagaaaggaaagatttgatagcttatctcaaagaagctactaatgagtaa

DBGET integrated database retrieval system