KEGG   Desmodus rotundus (common vampire bat): 112307260
Entry
112307260         CDS       T05907                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3 isoform X1
  KO
K17448  SHC-transforming protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04062  Chemokine signaling pathway
dro04072  Phospholipase D signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04722  Neurotrophin signaling pathway
dro04910  Insulin signaling pathway
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04926  Relaxin signaling pathway
dro04935  Growth hormone synthesis, secretion and action
dro05034  Alcoholism
dro05100  Bacterial invasion of epithelial cells
dro05214  Glioma
dro05220  Chronic myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112307260 (SHC3)
   04014 Ras signaling pathway
    112307260 (SHC3)
   04072 Phospholipase D signaling pathway
    112307260 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112307260 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112307260 (SHC3)
   04062 Chemokine signaling pathway
    112307260 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112307260 (SHC3)
   04915 Estrogen signaling pathway
    112307260 (SHC3)
   04917 Prolactin signaling pathway
    112307260 (SHC3)
   04926 Relaxin signaling pathway
    112307260 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    112307260 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112307260 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112307260 (SHC3)
   05226 Gastric cancer
    112307260 (SHC3)
   05214 Glioma
    112307260 (SHC3)
   05220 Chronic myeloid leukemia
    112307260 (SHC3)
   05224 Breast cancer
    112307260 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    112307260 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112307260 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112307260 (SHC3)
   01522 Endocrine resistance
    112307260 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 112307260
NCBI-ProteinID: XP_024419126
LinkDB
Position
Unknown
AA seq 588 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVNSSGKVSAARAAPAAAPYLASRDSLHRAPDDGS
GSLGHLLHKVSHLKLSSSGLRGLSAARERAGARLSGSCSAPSLAARDSRAPPGPRTPAMR
ASRKGRQGEELPPHIGPTSDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGTKGAFRKRKPPSKMLSSILGKSNLQFAGMNISLTVSTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFK
QYLQCPSKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPKKTPPSGGFVDSRLKARPHA
PDTAQFSGKEQTYYQGRHLGDPFGEEWQQAPVRQGSMDTYSMPEGKAHVAPMGEAPAYVN
TQHFPLQAGPAVGSSAESSPRKDLFDMKPFEDALKNQSMGPVLSKAASVECISPVSPRAL
DAAMLEELKAEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHDGQAKHLLL
VDPEGTIRTKDKIFDSISHLINHHLDNNLPIVSSGSELCLHQPVEKNP
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactccgtgacatctgtcgatgac
cttctgcataacctgtcggtgaacagcagcggcaaggtctcggcagcgcgcgcagccccg
gcggcggccccctacctggcgtccagagactcgctgcacagggctcctgacgatggctcg
ggcagcctgggtcacctgctccacaaggtgtcccacctaaaactctccagctcgggtctc
cgaggcctgtctgcggccagggagcgggcgggcgcgcggctctcgggcagctgcagcgcg
cctagcttggccgcccgggacagcagagcgccccccggccctcgcaccccggccatgcgc
gcctccaggaagggccggcagggtgaggagctgccaccccacataggccccaccagcgac
caggtgctgggggccggagtcacctacgttgtcaagtacttggggtgcatcgaagttcta
cgctcaatgaggtctcttgacttcagtacaaggacacaaattaccagggaagccatcagc
cgcgtttgtgaagctgttcctggcaccaagggagccttcaggaagagaaagcctccaagc
aaaatgctgtcaagcatcttgggcaagagcaacctccagtttgcggggatgaacatctcc
ctgactgtatccaccgccagcctgaacctgcggacgccggactcaaaacagattatagcg
aatcaccacatgcagtccatctccttcgcctccgggggggacccggacacaacagactat
gttgcatatgtagctaaggaccctgttaatcgcagagcttgtcacattctggaatgctgt
gatgggctggcccaggacgtcattggctccattggacaagcttttgagctccgatttaag
cagtatttgcagtgtccttccaagattcccgctcttcatgaccgaatgcagagtctggat
gagccatggactgaggaggagggtgatggctcagatcacccatactacaacagcattcca
aagaagactcctccttcaggggggtttgttgattctcgactgaaagccagaccccatgcc
cctgacacagcgcagttttcaggaaaagagcaaacttattaccagggaagacacttagga
gacccatttggtgaagagtggcagcaagcacctgtcaggcaagggtccatggacacctac
agcatgccagaagggaaagcacacgtggcccctatgggagaagcccctgcctacgtgaat
acccagcatttccctctgcaggctggaccggctgtaggaagcagcgcagagagcagcccc
aggaaggacctctttgacatgaaaccttttgaggatgctcttaagaaccagtccatggga
ccagtgctgagcaaagctgcctctgtggagtgcatcagccctgtctcacccagagccctg
gatgctgcaatgcttgaagagctgaaggctgagccttggtaccaaggtgagatgagcagg
aaggaggcagaggggctgctgaagcgagatggagacttcctggtcaggaagagtaccacc
aaccctggctcctttgttctcactggaatgcacgatggccaggccaagcatcttctgctc
gtggacccggaaggcacgatccggacaaaggacaagatctttgacagcatcagccacctc
atcaatcaccatctggataacaacctgcccattgtctcctccgggagtgagctatgcctc
catcagcccgtggagaagaacccatga

KEGG   Desmodus rotundus (common vampire bat): 112311774
Entry
112311774         CDS       T05907                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04062  Chemokine signaling pathway
dro04072  Phospholipase D signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04722  Neurotrophin signaling pathway
dro04910  Insulin signaling pathway
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04926  Relaxin signaling pathway
dro04935  Growth hormone synthesis, secretion and action
dro05034  Alcoholism
dro05100  Bacterial invasion of epithelial cells
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05220  Chronic myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112311774 (SHC4)
   04014 Ras signaling pathway
    112311774 (SHC4)
   04072 Phospholipase D signaling pathway
    112311774 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112311774 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112311774 (SHC4)
   04062 Chemokine signaling pathway
    112311774 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112311774 (SHC4)
   04915 Estrogen signaling pathway
    112311774 (SHC4)
   04917 Prolactin signaling pathway
    112311774 (SHC4)
   04926 Relaxin signaling pathway
    112311774 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    112311774 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112311774 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112311774 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112311774 (SHC4)
   05226 Gastric cancer
    112311774 (SHC4)
   05214 Glioma
    112311774 (SHC4)
   05220 Chronic myeloid leukemia
    112311774 (SHC4)
   05224 Breast cancer
    112311774 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    112311774 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112311774 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112311774 (SHC4)
   01522 Endocrine resistance
    112311774 (SHC4)
SSDB
Motif
Pfam: PID SH2 DUF1556 Delta_lysin
Other DBs
NCBI-GeneID: 112311774
NCBI-ProteinID: XP_024423993
LinkDB
Position
Unknown
AA seq 630 aa
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKGSPQPPC
PALAPHLPAEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPNSPASPETSLNRSGSAPPPQQDVVRLRATAVTPDACPLPGPGAPTPGSRQDRH
FLQHLLGMGMNYYVKYMGCIEVLQSMRSLDFGKRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDA
TDYVAYVAKDPVNQRACHILECSNGMAQEVISTIGQAFELRFKQYLKNPSLSASCESEEV
HIEGHAEEREDHEYYNEIPGKQPPMGGISDVRIKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRATGNAHERGVQSRRDTSLMKHTCRVDLFDDPCYINTQALQSTLSPARN
QSSAQPTGSLWHREKGPETVQPGATAQPASSLSLPHINQQLRDEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDSVGHLIRYHMDK
SLPIISSGSEVSLKQPVRKDNIPGLLHLNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtcaggacagcttggcaggactcgtgctgtatgtaggactcttcggg
cacccagggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacgtcc
ttggacgaaggcagtcccggaggctccgtagggaacaagggctcgccgcagcctccctgc
ccggcgctggcgcctcacttgccggctgaagatgccaccttggcgtcccaggagagcccc
accccactgtgcaccttgatcccgcgtatggcaagcgtaaagctagcaaacccagccacc
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtaccccgcctgaagctccag
gagagccaggatccggctcccaatagcccggcttcccccgaaaccagtctaaataggtcc
gggtctgcacccccgccacagcaggacgtggtgaggctcagggcaaccgccgtaactccc
gatgcctgcccccttccgggccctggggcgccaaccccagggagcaggcaggacaggcac
tttctgcagcacctgttggggatgggcatgaactactatgtgaagtacatgggctgtatt
gaagtgctgcaatcgatgaggtcactggattttgggaagagaactcaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggcaaatggagccataaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcggggatg
aatataaaactgaccatctcaacatgcagcctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgacgct
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatactg
gaatgcagcaacggaatggcccaggaagtcataagtaccatagggcaggcttttgagctc
cggtttaaacaatatttgaaaaatccctctttgagtgcttcttgtgaaagtgaggaggtg
catattgaaggccacgcggaggaaagagaagatcatgagtattacaatgaaataccagga
aagcagccacccatgggtggcatttcagatgtgcggatcaaagttcaagccacagaacaa
atggcttactgcccaatacggtgtgaaaagttgtgctatttgcctggcaactccaagtgc
agcagcgtgtatgagaactgtttggagcaaagcagggcaacaggtaatgcccatgagaga
ggggtgcagtcccgaagagacacctcactgatgaagcacacatgtcgagtggatctcttc
gacgacccctgctacattaatacgcaggctcttcaaagtacactcagtcctgcccgaaat
caaagctcagctcagccaacaggcagcctgtggcaccgtgaaaaaggaccagaaactgtt
cagccaggtgccacggcccagcctgccagctcactttctttgccacacattaatcagcag
ctgcgggatgaagactgctaccatggcaagttgagcaggaaagcggcagagagcctctta
gtaaaggatggggactttttggttcgagagagtgcaacgtctcctggccaatatgtgctg
agtggactacagggaggccaggccaaacatcttcttctggtggatcctgaaggcaaggtg
aggaccaaggatcacgtatttgatagcgtcggccacctcatcagataccacatggataag
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
aatattccaggacttttgcatttaaacaaataa

KEGG   Desmodus rotundus (common vampire bat): 112312297
Entry
112312297         CDS       T05907                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04062  Chemokine signaling pathway
dro04072  Phospholipase D signaling pathway
dro04370  VEGF signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04722  Neurotrophin signaling pathway
dro04910  Insulin signaling pathway
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04926  Relaxin signaling pathway
dro04935  Growth hormone synthesis, secretion and action
dro05034  Alcoholism
dro05100  Bacterial invasion of epithelial cells
dro05214  Glioma
dro05220  Chronic myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112312297 (SHC2)
   04014 Ras signaling pathway
    112312297 (SHC2)
   04370 VEGF signaling pathway
    112312297 (SHC2)
   04072 Phospholipase D signaling pathway
    112312297 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112312297 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112312297 (SHC2)
   04062 Chemokine signaling pathway
    112312297 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112312297 (SHC2)
   04915 Estrogen signaling pathway
    112312297 (SHC2)
   04917 Prolactin signaling pathway
    112312297 (SHC2)
   04926 Relaxin signaling pathway
    112312297 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    112312297 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112312297 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112312297 (SHC2)
   05226 Gastric cancer
    112312297 (SHC2)
   05214 Glioma
    112312297 (SHC2)
   05220 Chronic myeloid leukemia
    112312297 (SHC2)
   05224 Breast cancer
    112312297 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    112312297 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112312297 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112312297 (SHC2)
   01522 Endocrine resistance
    112312297 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 112312297
NCBI-ProteinID: XP_024424473
LinkDB
Position
Unknown
AA seq 498 aa
RCAAPCPLPALSRCRTAGTRGSRGARGAAGPSDSVADEWIRKGSFIHKPAHGWLHPDARV
LGPGVSYIVRYMGCIEVLRSMRSLDFSTRTQVTREAINRLHEAVPGVRGSWKKKAPNKAL
ASILGKSNLRFAGMSIAVSISTDGLNLSVPATRQVIANHHMQSISFASGGDTDMTDYVAY
VAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKVVVPPERLTGLEESA
WGDEEDSEHNYYNSIPGKEPPLGGLVDSRLTLTQPCALGALGALSQGASPPRRDTRGLHW
ELGPSAPPGDGYVQADAQGPRDYEDHLYVNTQGLDTLELLQPEDSPKKDLFDMRPFEDAL
KLHECSVAAGAVAPLPLEDQWPSPPTRRAPIAPTEEQLRQEPWYHGQMSRRAAEKLLRAD
GDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESISHLIDYHLQNGQP
IVAAESELHLRGVVKREP
NT seq 1497 nt   +upstreamnt  +downstreamnt
cgctgcgccgcgccctgccccctgccggctctcagccgctgccggactgccgggacgcgg
gggtctcggggggcgcggggggctgccggaccctcagactccgtcgccgacgagtggatc
cgcaaaggcagcttcatccacaagccggcgcacggctggctacacccagacgccagggtc
ctggggccgggggtctcctacatcgttcggtacatgggctgcattgaggtcctacgctcc
atgcgctccctggacttcagcactcgtacccaggttaccagggaagccatcaaccggctc
catgaggctgtgcctggagtccggggctcctggaaaaagaaggcccccaacaaggcgctg
gcctccatcctgggcaagagcaacctgcgcttcgccggcatgagcattgctgttagcatc
tctactgatggcctcaacctctccgtgcctgccacgcgccaggtcattgccaaccaccac
atgcagtccatctccttcgcgtcgggcggtgacacggacatgacggattatgtggcctat
gtcgctaaggaccccattaaccagagagcctgccacatcctggagtgctgcgagggcctc
gcccagagcgtcatcagcactgtgggccaagcctttgagctgcgcttcaaacagtacctg
cacagcccccccaaggttgtcgtcccccctgaaaggctgaccgggttggaggagtcggca
tggggggatgaggaggactcagaacacaattactacaacagcatcccaggcaaggagccg
cccctgggcgggctggtggactccaggctcaccttgacacaaccctgcgcccttggggcc
ctaggagccctcagccagggagcatctcctcctcgaagagacacccgaggcctgcattgg
gagctgggcccctcagccccaccaggggatggctacgtgcaggcggatgcccagggcccc
cgtgattacgaggaccacctgtacgtcaacacacagggtctcgacacactggagcttctg
cagcccgaggacagccccaagaaggatctgttcgacatgcgacccttcgaggatgctctg
aagctgcacgagtgctctgtggcagcgggcgcggtggctccccttcctttggaggaccag
tggcccagtccccccacccgcagggcccccatcgcccccacagaggagcagctgcggcag
gagccttggtaccacggccagatgagccgtcgggcggcggagaaactgctgcgagccgac
ggggacttcctcgtgcgcgatagcgtcaccaaccccgggcagtatgtgctcacgggcatg
cacgcggggcagcccaagcacctgctgcttgtggaccctgagggcgtggtgcggacgaag
gacgtgctgttcgagagcatcagccacctgatcgactatcacctgcagaacgggcagccc
atcgtggctgctgagagcgagctgcacttgcgcggcgtggtcaagcgggagccctga

KEGG   Desmodus rotundus (common vampire bat): 112316734
Entry
112316734         CDS       T05907                                 

Gene name
SHC1
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01521  EGFR tyrosine kinase inhibitor resistance
dro01522  Endocrine resistance
dro04012  ErbB signaling pathway
dro04014  Ras signaling pathway
dro04062  Chemokine signaling pathway
dro04072  Phospholipase D signaling pathway
dro04510  Focal adhesion
dro04650  Natural killer cell mediated cytotoxicity
dro04722  Neurotrophin signaling pathway
dro04910  Insulin signaling pathway
dro04915  Estrogen signaling pathway
dro04917  Prolactin signaling pathway
dro04926  Relaxin signaling pathway
dro04935  Growth hormone synthesis, secretion and action
dro05034  Alcoholism
dro05100  Bacterial invasion of epithelial cells
dro05206  MicroRNAs in cancer
dro05214  Glioma
dro05220  Chronic myeloid leukemia
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112316734 (SHC1)
   04014 Ras signaling pathway
    112316734 (SHC1)
   04072 Phospholipase D signaling pathway
    112316734 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112316734 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112316734 (SHC1)
   04062 Chemokine signaling pathway
    112316734 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112316734 (SHC1)
   04915 Estrogen signaling pathway
    112316734 (SHC1)
   04917 Prolactin signaling pathway
    112316734 (SHC1)
   04926 Relaxin signaling pathway
    112316734 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    112316734 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112316734 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112316734 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112316734 (SHC1)
   05226 Gastric cancer
    112316734 (SHC1)
   05214 Glioma
    112316734 (SHC1)
   05220 Chronic myeloid leukemia
    112316734 (SHC1)
   05224 Breast cancer
    112316734 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    112316734 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112316734 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112316734 (SHC1)
   01522 Endocrine resistance
    112316734 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 112316734
NCBI-ProteinID: XP_024429388
LinkDB
Position
Unknown
AA seq 577 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGTIGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGXWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQ
VTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAA
DCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQ
AFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDM
RLREGATPGPARSTLPSTQTPSHLGATLPVGQPVGADLEVHKQMPPLPPCPGRELFDDPS
YVNVQNLDKARQAGGGAGPPNLAVNGSAPRDLFDMKPFEDALRVPPPPQSMAMAEQLRGE
PWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKD
HRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccacttcggaatgagtctctgtcatcg
ctggaagagggggcttcggggtccaccccaccggaggaactgccttccccatcagcctct
tccctggggcccatcctgccacctctgcctggcgatgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggccaacccggctggggggcgcccggggcca
aagggggagccaggcagggctgccgaggatggggaggggactataggggcagccatgcca
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggnngtggacccgccacgggagctttgtcaataagcctacgagg
ggctggctgcatcctaacgacaaagtcatgggacctggggtttcctacttggttcggtac
atgggctgtgtggaggtcctgcagtcaatgcgtgccctggacttcaacacccgaactcaa
gtcaccagggaggccatcagtctggtgtgtgaggctgtgccaggtgctaagggggctaca
agaaggagaaagccctgtagccgcccactcagttccattctggggaggagtaacctgaaa
tttgctggaatgccaatcactctcaccgtctccaccagcagcctcaacctcatggccgca
gactgcaaacagatcattgccaaccaccacatgcagtctatctcgtttgcgtccggcggg
gacccggacaccgctgagtatgtcgcctatgttgccaaagacccggtgaatcagagagcc
tgccacatcctggagtgtcccgaagggcttgctcaggacgtcatcagcaccatcggccag
gccttcgagttacgattcaaacaatacctcaggaacccacccaagctggtcaccccccac
gacaggatggctggctttgatggctcagcttgggatgaggaggaggaagagccacctgac
catcaatactataatgacttcccggggaaggaaccccctcttgggggggtggtagacatg
aggcttcgggaaggagctacccccgggcctgctcgatccactctgcccagtacccagacc
cccagccacctgggagctacactgcctgtggggcagcctgttggggcagacctggaagtc
cataagcagatgccacctctgccaccctgcccaggcagagagctctttgatgatccttcc
tatgtcaacgtccagaacctggacaaggcccggcaagcagggggtggggccggacccccc
aatcttgctgtcaatggcagtgcgcctcgagacctctttgacatgaagccctttgaagat
gcccttcgggtgcctccacctccccagtcgatggccatggctgagcagctccgaggggag
ccctggttccatggaaagctgagccggcgggaggccgaagccctgctgcagctcaacggg
gacttcctggtgcgggaaagcacgaccacccctggccaatatgtgctcactggcttgcag
agtgggcagcccaagcacctgctgctggtggaccctgagggtgtggtccggacgaaggat
caccgcttcgagagtgtcagtcacctcatcagttaccacatggacaatcacttgcccatc
atttctgcgggcagcgaactgtgtctacagcaacctgtggagcgaaaattgtga

DBGET integrated database retrieval system