KEGG   Desmodus rotundus (common vampire bat): 112307265
Entry
112307265         CDS       T05907                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04064  NF-kappa B signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112307265 (GADD45G)
   04064 NF-kappa B signaling pathway
    112307265 (GADD45G)
   04068 FoxO signaling pathway
    112307265 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112307265 (GADD45G)
   04210 Apoptosis
    112307265 (GADD45G)
   04115 p53 signaling pathway
    112307265 (GADD45G)
   04218 Cellular senescence
    112307265 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307265 (GADD45G)
   05202 Transcriptional misregulation in cancer
    112307265 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112307265 (GADD45G)
   05212 Pancreatic cancer
    112307265 (GADD45G)
   05225 Hepatocellular carcinoma
    112307265 (GADD45G)
   05226 Gastric cancer
    112307265 (GADD45G)
   05214 Glioma
    112307265 (GADD45G)
   05216 Thyroid cancer
    112307265 (GADD45G)
   05220 Chronic myeloid leukemia
    112307265 (GADD45G)
   05217 Basal cell carcinoma
    112307265 (GADD45G)
   05218 Melanoma
    112307265 (GADD45G)
   05213 Endometrial cancer
    112307265 (GADD45G)
   05224 Breast cancer
    112307265 (GADD45G)
   05222 Small cell lung cancer
    112307265 (GADD45G)
   05223 Non-small cell lung cancer
    112307265 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112307265 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112307265 (GADD45G)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112307265 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112307265 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112307265
NCBI-ProteinID: XP_024419131
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRGQDSVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEGSAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacactggaagaagtccgcggccaggactcggttccggaaagcacagccaggatgcag
ggcgcagggaaagcgctgcacgagttgctgctgtcagctcagcgccagggctgcctcact
gctggcgtctacgaatcagccaaagtcctgaacgtggaccccgacaatgtaaccttctgc
gtgctggccgcggatgaggaggacgagggcgacatcgcgctgcagattcatttcacgctg
atccaagcgttctgttgcgaaaacgacatcgatatcgttcgtgtgggcgatgtgcagcgg
ctggcggccatcgtgggcgctggcgatgaggggagtgctccaggagaccttcactgtatc
ctcatttcgaaccccaatgaggatgcatggaaggaccccgcgttggagaagctcagtctg
ttctgcgaagagagccgcagcgtcaatgactgggtgcccagtatcactctccccgagtga

KEGG   Desmodus rotundus (common vampire bat): 112309280
Entry
112309280         CDS       T05907                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04064  NF-kappa B signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112309280 (GADD45A)
   04064 NF-kappa B signaling pathway
    112309280 (GADD45A)
   04068 FoxO signaling pathway
    112309280 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112309280 (GADD45A)
   04210 Apoptosis
    112309280 (GADD45A)
   04115 p53 signaling pathway
    112309280 (GADD45A)
   04218 Cellular senescence
    112309280 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309280 (GADD45A)
   05202 Transcriptional misregulation in cancer
    112309280 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112309280 (GADD45A)
   05212 Pancreatic cancer
    112309280 (GADD45A)
   05225 Hepatocellular carcinoma
    112309280 (GADD45A)
   05226 Gastric cancer
    112309280 (GADD45A)
   05214 Glioma
    112309280 (GADD45A)
   05216 Thyroid cancer
    112309280 (GADD45A)
   05220 Chronic myeloid leukemia
    112309280 (GADD45A)
   05217 Basal cell carcinoma
    112309280 (GADD45A)
   05218 Melanoma
    112309280 (GADD45A)
   05213 Endometrial cancer
    112309280 (GADD45A)
   05224 Breast cancer
    112309280 (GADD45A)
   05222 Small cell lung cancer
    112309280 (GADD45A)
   05223 Non-small cell lung cancer
    112309280 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112309280 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112309280 (GADD45A)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112309280 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112309280 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112309280
NCBI-ProteinID: XP_024421254
LinkDB
Position
Unknown
AA seq 166 aa
MTLEEFSAGEQQTERMDKEVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLL
AADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAKLLLLETDASPGASEGAEQP
PDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 501 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggcgagcaacagaccgaaaggatggataaggaggtg
ggggatgcccttgaggaagtgctgagcaaagccctgagtcagcgcaccatcacggtcggg
gtgtacgaggcggccaagcttctcaacgtcgacccggataacgtggtgctgtgcctgctg
gccgcagacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccag
gcattctgctgcgagaacgacatcaacatcctgcgcgtcagcaaccctggccgcttggcg
aaactcctgctgctggagaccgacgcgagcccgggggcgagcgagggcgcagagcagccc
ccagacttgcactgcgtgctagtgacgaatccacattcatcgcaatggaaggatcctgcc
ttaagtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtg
attaatctccctgaacggtga

KEGG   Desmodus rotundus (common vampire bat): 112312272
Entry
112312272         CDS       T05907                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04064  NF-kappa B signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112312272
   04064 NF-kappa B signaling pathway
    112312272
   04068 FoxO signaling pathway
    112312272
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112312272
   04210 Apoptosis
    112312272
   04115 p53 signaling pathway
    112312272
   04218 Cellular senescence
    112312272
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312272
   05202 Transcriptional misregulation in cancer
    112312272
  09162 Cancer: specific types
   05210 Colorectal cancer
    112312272
   05212 Pancreatic cancer
    112312272
   05225 Hepatocellular carcinoma
    112312272
   05226 Gastric cancer
    112312272
   05214 Glioma
    112312272
   05216 Thyroid cancer
    112312272
   05220 Chronic myeloid leukemia
    112312272
   05217 Basal cell carcinoma
    112312272
   05218 Melanoma
    112312272
   05213 Endometrial cancer
    112312272
   05224 Breast cancer
    112312272
   05222 Small cell lung cancer
    112312272
   05223 Non-small cell lung cancer
    112312272
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112312272
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112312272
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112312272
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112312272
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112312272
NCBI-ProteinID: XP_024424446
LinkDB
Position
Unknown
AA seq 106 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRYTYSIWEYP
NT seq 321 nt   +upstreamnt  +downstreamnt
atgactctggaagagctggtggcgtgcgacaacgcagcacagaagatgcagacggtgagc
gccgcggtggaggagctgctagtggctgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagtgtggtcctgtgcctgttggcc
attgacgaggaagaggaggatgatattgccctgcagatccacttcacgctcattcagtcc
ttttgctgtgacaacgacatcaatattgtccgagtgtctggcatgcaacgctatacctac
agtatctgggaatatccttag

KEGG   Desmodus rotundus (common vampire bat): 112312410
Entry
112312410         CDS       T05907                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04064  NF-kappa B signaling pathway
dro04068  FoxO signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04210  Apoptosis
dro04218  Cellular senescence
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112312410
   04064 NF-kappa B signaling pathway
    112312410
   04068 FoxO signaling pathway
    112312410
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112312410
   04210 Apoptosis
    112312410
   04115 p53 signaling pathway
    112312410
   04218 Cellular senescence
    112312410
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112312410
   05202 Transcriptional misregulation in cancer
    112312410
  09162 Cancer: specific types
   05210 Colorectal cancer
    112312410
   05212 Pancreatic cancer
    112312410
   05225 Hepatocellular carcinoma
    112312410
   05226 Gastric cancer
    112312410
   05214 Glioma
    112312410
   05216 Thyroid cancer
    112312410
   05220 Chronic myeloid leukemia
    112312410
   05217 Basal cell carcinoma
    112312410
   05218 Melanoma
    112312410
   05213 Endometrial cancer
    112312410
   05224 Breast cancer
    112312410
   05222 Small cell lung cancer
    112312410
   05223 Non-small cell lung cancer
    112312410
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112312410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dro03036]
    112312410
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     112312410
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112312410
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 112312410
NCBI-ProteinID: XP_024424641
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHSLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactctggaagagctggtggcgtgcgacaacgcagcacagaagatgcagacggtgagc
gccgcggtggaggagctgctagtggctgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagtgtggtcctgtgcctgttggcc
attgacgaggaagaggaggatgatattgccctgcagatccacttcacgctcattcagtcc
ttttgctgtgacaacgacatcaatattgtccgagtgtctggcatgcaacgcctggcacag
ctgctgggggagccagccgagacccaaggcaccactgaagcccgagacctgcactgcctc
ctggtcacgaaccctcacacagatgcctggaagagccacagcctggtggaggtagccagt
tactgtgaagagagccgggggaacaaccagtgggtcccctacatttccctccaggagcgc
tga

DBGET integrated database retrieval system