KEGG   Desmodus rotundus (common vampire bat): 112307522
Entry
112307522         CDS       T05907                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03460  Fanconi anemia pathway
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    112307522 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112307522 (POLK)
   05202 Transcriptional misregulation in cancer
    112307522 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112307522 (POLK)
   05212 Pancreatic cancer
    112307522 (POLK)
   05225 Hepatocellular carcinoma
    112307522 (POLK)
   05226 Gastric cancer
    112307522 (POLK)
   05214 Glioma
    112307522 (POLK)
   05216 Thyroid cancer
    112307522 (POLK)
   05220 Chronic myeloid leukemia
    112307522 (POLK)
   05217 Basal cell carcinoma
    112307522 (POLK)
   05218 Melanoma
    112307522 (POLK)
   05213 Endometrial cancer
    112307522 (POLK)
   05224 Breast cancer
    112307522 (POLK)
   05222 Small cell lung cancer
    112307522 (POLK)
   05223 Non-small cell lung cancer
    112307522 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112307522 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112307522 (POLK)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     112307522 (POLK)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    112307522 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH
Other DBs
NCBI-GeneID: 112307522
NCBI-ProteinID: XP_024419352
LinkDB
Position
Unknown
AA seq 866 aa
MDSPKEKNDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYENELKKEKQV
NQRIKNMLQQKAQITSQQLRKAQLQVDRCAMELEQSRDLTNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSSSMLSTSNYHARRFGVRAAMPGFIAKKLCPQLTIVPPNFDIYRAVSRE
VKEILADYDPNFMATSLDEAYLNITTHLQERQNWPEDKRKYFIKTGNSLENGKPEKELNK
LSEHERSISPLLFEDSPPDLQPPRNTSQVNSEQNNPQTVQNSVVFGTSAEEVVKEIRFRI
EQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPLRKVSGIGKVT
EKMLKALGIITCTELYEQRALLSLLFSETSWRYFLQISMGLGSTHLPRDGERKSMSVERT
FSEMSKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVSTA
EEIFAIAKELLRTEIDADFPRPLRLRLMGVRLSSFLNEEDKKHQQRSIVGFLQSGDQALS
GTGCVEKNDKDQFLKPVEMSHKKSFFDKKRSEKKWSHQDTFKCETVNRQDVQTSQSFQVL
KKMSENLETSETSDNNQVFTCPVCFREQGSISLEAFHKHVDACLHGPSMREMFSCSHASS
TKVHKKENIHHSFSLCEKQHYETHRKNTEINSEDCAELVETIGNPSEVESVDALSNKLSK
EECSSLPSTSFNIEHCHQNSSCTVALESEDAGSLRRQEPPQPCLYEEITDQALTCPVCNL
EQKTSDLTQFNVHVDICLNTGIIQELKKDKVNPVNQPKESTKSTGNSGRVQKAVTKTKRS
GLTTKYSASKKIKPNNPRHTLDIFFK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggacagcccaaaggaaaagaatgacagttacaaagatgaccttctgcttaggatggga
ctgaacgataataaagctgggatggaaggattagataaagagaaaataaacaaaattata
atggaagccacaaagggctccaagttttatgaaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattaaaaatatgttgcaacaaaaagctcaaattaccagccagcagctaagg
aaagcacaattacaggttgacagatgtgcaatggaattggaacagagccgggacctgacc
aataccatagtgcacattgacatggatgccttctatgcagctgtagaaatgagggacaat
ccagagctgaaggataaacccattgctgtaggatcatctagtatgttgagtacctcaaat
taccatgcaaggaggtttggagttcgcgcagccatgccaggatttattgctaaaaaactc
tgcccacaacttactatagtgcctccaaacttcgacatataccgagctgtgagtagagag
gttaaggaaatacttgctgattatgatcccaattttatggccacgagtctcgacgaagcc
tacttgaatataacaacgcacttacaggaaagacaaaattggcctgaggacaaaagaaaa
tatttcatcaaaacagggaactctctagaaaatggtaagccagaaaaggaacttaataaa
ctgagtgagcatgaacgatccatctctccattactttttgaagatagtcctcctgatttg
cagcccccaagaaatacttcccaagtgaacagtgaacaaaataatcctcaaacagttcaa
aactccgttgtttttggaacatcagccgaggaagtggtaaaggaaattcgtttcagaatc
gagcaaaaaacaacactgacggccagtgcaggcattgccccaaatacaatgttagcaaaa
gtatgcagtgataagaataaaccaaatggacaataccagattctccccaacagacaagct
gtgatggatttcatcaaggacttaccccttagaaaggtttctggaataggaaaagttaca
gagaaaatgttaaaggcccttgggattattacttgtacagaactctacgaacagagggca
ttactttctcttcttttctctgaaacatcttggcgttatttcctacagatttccatgggt
ctgggttcaacacacctgccaagggatggagaaaggaaaagcatgagcgttgagaggaca
ttcagtgagatgagtaaagcagaagaacagtacagcttgtgccaggaactttgcagtgaa
cttgctcaagatctgcagaaagaaggacttaagggtagaactgttaccattaagctgaag
aatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtgtctactgca
gaagaaatatttgctattgctaaagaattgctaagaacagaaattgatgctgattttcca
cgtcccttgaggttaagacttatgggtgtgcggctatctagttttcttaatgaggaagat
aagaaacaccaacaaaggagtattgttggtttcttacagtctggagaccaagccctgtca
ggcactgggtgtgtggagaaaaatgacaaagatcagtttttaaaacctgtagaaatgtct
cataagaagagtttttttgataaaaaacgatcagaaaagaaatggagccaccaagacaca
tttaagtgtgaaactgtgaatagacaagatgtgcagacatcacaatcattccaagtttta
aagaagatgagtgagaatttagaaacatcagagacttcggataacaatcaggtatttacc
tgtcctgtttgctttcgggagcagggaagcatcagtctggaagcctttcataaacatgta
gatgcgtgtcttcatgggccttcgatgagggaaatgttctcatgttcacatgcttcctct
acgaaagttcacaagaaagaaaacattcaccattctttttccctctgtgagaagcagcat
tatgaaacccatcgaaagaatacagaaatcaattcagaagattgtgccgagttggtagag
actataggtaatccatctgaagtagaaagtgtagatgctttaagtaataagcttagcaaa
gaggaatgttctagccttccaagcacatcgtttaatattgaacactgtcatcagaattct
tcctgtactgttgcattggaaagcgaagatgctgggtcactgagaaggcaagaacccccc
cagccttgtttatatgaagagataacagaccaggctctaacttgtccggtttgtaaccta
gagcaaaaaacttcagatcttacccagttcaatgtgcatgtggatatttgcttaaataca
ggcataatccaggaacttaaaaaggataaagttaatccagtaaaccaacccaaagaaagc
accaaaagtactggtaactcaggcagagtacagaaggctgtaacaaaaacgaagagatca
ggattgacgacaaagtactcagcatcaaagaaaataaaaccaaacaatcccagacatacc
cttgatatattttttaaatga

DBGET integrated database retrieval system