KEGG   Desmodus rotundus (common vampire bat): 112308272Help
Entry
112308272         CDS       T05907                                 

Gene name
IQCA1L
Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
dro  Desmodus rotundus (common vampire bat)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ Imm-NTF2 AAA_16 AAA_5 RsgA_GTPase HORMA
Motif
Other DBs
NCBI-GeneID: 112308272
NCBI-ProteinID: XP_024420223
LinkDB All DBs
Position
Unknown
AA seq 812 aa AA seqDB search
MSEGAYQRLWDSSHVTLQELLDQEQPLLQLAASRERQSFQYRLSLLYLYYLALMRRFDTL
YDQMVQPQKRRLLRRLLDSVAGRVLELKDEMVRVDLCECHHLDRLLQDLQLTPAELEVPI
PKYFQQEQFSILHERGLLLDEILHRTEPVTFQASIPEMSRTEAIILLQTAERARQGRIRA
NFIREIRREEERDRKMKESGRPKFNQDQAAITIQKVWKGYLQRKHTQQDRQKEMEFIGML
PLPNQGEDSSILFQASVREDARRLRQKEEEEEFQLAVVKTQSYLRETEGPYMKEKIQGQI
RQWFIECHDLTGRFPDYPEESLGGSHLIFSDKTPDEVKMELEMQAQESKRKDQDQKKENE
KKKEKKEKTGKGEADTMLKVLPSRSIPLISAGHEEYTNVWKNRHDNIYPNQSFDPEALRL
EQRKEMEQEIRIQVDELMRQELKSLRLAVDREEDRPFKALKKKNEKKAGRKKEKDLTPDR
SMSSLFEELVVYGFLKKSETVALKDFVGDYLYLGSTLSLANKLPMPSLFDIRQNVALYGV
LRLGSPDIHSMAPLIRSILLVGPSGMGKKMLVNAVCTETGANLFDLSPANLQDKYPGKTG
VQMIVHIVFKVARLLQPSVIWIGNAEKNFYKKVPKEEEEMDPKRVRKDLTKALQLLGPGD
RVMLIGTTNQPQLAEMKGLCRTYERILFMPRPDYASRYVLWKHMLEAQGAKVTQSLDLSA
LAMVSDGYTPGHILQAIRWVLTERRIMQLSKRPLVASEFLAYLAQLEPVHREEEESLKDW
YFRTPLGMSRMKLDKDQDDKGAKLAKDKKQQK
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggagcataccaacgcctctgggactcctcccatgtgactctgcaagagctg
ctggaccaggagcagcccctgctccaactggcggccagccgcgagcggcagtctttccag
taccggctctcgttgctctacttgtactacctggcgcttatgcgccggttcgacaccctt
tacgaccagatggtgcagccgcaaaagcggcggctgctgcggcgcctgctggacagcgtg
gcgggccgcgtgctggagctcaaggacgagatggtgcgtgtagacctgtgcgagtgccac
cacctggatcgcttgctgcaggacctccagctcaccccggcagagctggaggttccgatc
cccaaatacttccagcaggagcagttcagcattctgcacgagcgggggctgttactggac
gagatcctgcacaggacggagccagtgacctttcaggcgagcattccagaaatgtcccgg
actgaagccataatcctgctgcaaacagccgagcgggccaggcaaggccggatccgagcc
aacttcattcgagagattcggagagaggaggagcgggatcggaagatgaaggagagcgga
cggcccaagttcaatcaggaccaagcagctatcaccattcagaaggtgtggaaaggttac
ctgcagaggaaacacactcagcaggatcggcaaaaggagatggaattcattggcatgctc
ccgttgcccaaccagggggaggactcgagcatcctgttccaggccagtgtcagggaggat
gccaggaggctccgccagaaggaggaggaggaggagttccagctggctgtggtgaagacc
cagagctatctcagagagaccgaggggccctacatgaaggagaaaattcaggggcaaatc
cgacagtggtttattgagtgccatgaccttactggccgattccccgattatccagaagag
tctttaggtggatcccacctgatcttctcagacaagactccagacgaggtgaaaatggaa
ctggagatgcaggcccaggagagcaaaagaaaggaccaagaccaaaaaaaggaaaatgag
aagaagaaagaaaagaaagaaaagaccggaaaaggggaagcagatacgatgctgaaggtg
ttgccatccagatctatccccctgatcagtgctgggcatgaggagtatacaaatgtgtgg
aagaaccggcatgataatatataccccaatcagagttttgaccccgaggctctccggttg
gagcagaggaaggaaatggagcaggagatccggatacaggtggatgagctgatgcgtcaa
gagctgaagagcctgcgcctggctgtggaccgggaggaggacagacccttcaaggctctg
aagaaaaaaaatgagaagaaagctgggaggaagaaggaaaaagatctgaccccagacagg
tccatgtcctctctgtttgaagagctcgttgtctacggctttctgaagaagagcgagaca
gtggcactgaaggactttgttggtgactacctctaccttggatccactctgagtttggcc
aacaagcttcccatgccttccctgtttgacattcgacagaacgtggccttgtacggggtc
ctccggcttggctccccagatatacactccatggctcccctcatccgctccatcctcctg
gtgggcccctccggcatggggaagaagatgctggtcaatgccgtgtgcacagaaaccggc
gccaacctgttcgacctgtcccctgccaatctgcaggacaaataccctggcaagaccggg
gtgcagatgatcgtgcacatcgtctttaaggtggctcggctcctgcagccctcagtgatc
tggattgggaatgccgagaagaatttctataagaaggtcccaaaggaagaggaggagatg
gacccaaagcgagtaaggaaggacctcaccaaggccctgcagctgctgggccccggagac
cgcgtcatgctgatagggaccaccaaccagccgcagctcgctgagatgaaggggctgtgc
cggacctacgagcgcattctcttcatgcctcggcctgactatgcctctcgctatgtgctc
tggaagcacatgctggaagcccagggagccaaggtgacccagagcctggacctcagtgcc
ctggccatggtgtccgatggctacacgcccggccacattctccaagccatccgatgggtg
ctcaccgagcggaggattatgcaattgtccaagcgacccctggtggcctcagagttcttg
gcttacctggcacagctggagccagtgcacagagaggaggaagagtccctgaaggactgg
tacttcaggaccccgctgggcatgagcaggatgaaactcgacaaggaccaggatgacaag
ggggccaagctggcgaaggacaagaaacaacagaagtga

DBGET integrated database retrieval system