KEGG   Desmodus rotundus (common vampire bat): 112308288
Entry
112308288         CDS       T05907                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00220  Arginine biosynthesis
dro00330  Arginine and proline metabolism
dro01100  Metabolic pathways
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04066  HIF-1 signaling pathway
dro04071  Sphingolipid signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04370  VEGF signaling pathway
dro04371  Apelin signaling pathway
dro04611  Platelet activation
dro04915  Estrogen signaling pathway
dro04921  Oxytocin signaling pathway
dro04926  Relaxin signaling pathway
dro04931  Insulin resistance
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    112308288 (NOS3)
   00330 Arginine and proline metabolism
    112308288 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112308288 (NOS3)
   04371 Apelin signaling pathway
    112308288 (NOS3)
   04066 HIF-1 signaling pathway
    112308288 (NOS3)
   04020 Calcium signaling pathway
    112308288 (NOS3)
   04071 Sphingolipid signaling pathway
    112308288 (NOS3)
   04022 cGMP-PKG signaling pathway
    112308288 (NOS3)
   04151 PI3K-Akt signaling pathway
    112308288 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112308288 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112308288 (NOS3)
   04921 Oxytocin signaling pathway
    112308288 (NOS3)
   04926 Relaxin signaling pathway
    112308288 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112308288 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112308288 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112308288 (NOS3)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     112308288 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 EBP HTH_15
Other DBs
NCBI-GeneID: 112308288
NCBI-ProteinID: XP_024420250
LinkDB
Position
Unknown
AA seq 1221 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPTSEPSWTPAPAPAPAPPPAPDPSGLS
GVHPKENTSPAPNSPPHTRSPEGPKFPRVKNWVVGSITYDTLSAQAQQDGPCTPRRCLGS
LVFPRKLQSRPGQGPPPAEQLLSQARDFINQYYSSIKRGGSQAHEQRLQEVEAEVAATGT
YQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICSHIKYATNRG
NLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPG
NGRFDVLPLLLQAPDEPPELFTVPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLE
IGGLEFPAAPFSGWYMSSEIGMRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEI
NVAVLHSYQLSKVTIVDHHAATSSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQ
EMVNYFLSPAFRYQPDPWKGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATI
LYGSETGRAQGYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPEN
GESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGAL
GTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLPMGQGDELCGQEEAFRGWAKAA
FQASCETFCVGEDAKAATRDIFSPKRSWKRQRYRLSAQAEGLQLLPGLMHVHRRKMFQAT
VLSVENLQSSKSTRATILVRLDTGGQAWLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPP
PGEPVAVEQLEKGSPGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAE
EPGEQQELETLSQDPLHYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSV
SSAPSAHLGEIHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLP
PDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQ
DAQQRGVFGRVLTAFSREPDSPKTYVQDILRTELAAEVHRVLCLEGGHMFVCGDVTMATS
VLQTVQRILATEGDMELEEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQE
RHLRGAVPWAFDPPGSDTPAP
NT seq 3666 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagccggggccaccctgcggcctggggctgggg
ctgggcctcggcctgtgtggcaagcagggcccagcctccccgacatctgagcccagctgg
acaccagcacctgcacctgcacccgcacccccgcctgcgccagaccccagtgggctctct
ggggtacatccaaaagaaaacacttcccctgctcccaacagccccccgcacacccggtcc
ccagaggggcccaagttccctcgtgtgaagaactgggtagtggggagcatcacctacgac
accctgagtgcccaggcgcagcaggatgggccatgcacccctcgacgctgcctgggctcc
ctggtatttccacggaaactgcagagccggcccggccagggccccccgcccgccgagcag
ctgctgagccaggccagggacttcatcaaccagtactacagctccatcaagaggggcggc
tctcaggcccacgagcagaggcttcaggaggtggaagctgaggtggcagctacaggcacc
taccagcttcgggagagtgaactggtgttcggggccaagcaggcctggcgcaatgccccc
cgctgtgtgggccggatccagtgggggaagctgcaggtgtttgacgcccgggactgcagc
tctgcacaggagatgttcacctacatctgcagccacatcaagtacgctaccaaccgtggc
aacctccgctcggccatcacagtgttcccccagcgcgccccgggccgcggagacttccgg
atctggaacagccagttggtgcgctacgccggctacaggcagcaggacggctccgtgcgg
ggcgacccggccaacgtggagatcaccgagctctgcatccagcacggctggaccccaggc
aacggccgcttcgacgttctgcccctgctgctccaggccccagatgagcccccagaactc
ttcactgtgccccccgagctagtcctcgaggtgcctctggagcacccgacgctggagtgg
ttcgcagccctgggcctgcgctggtacgccctccccgctgtgtccaacatgctgctggaa
attgggggcctggagttccctgcggcccctttcagcggctggtacatgagctcagagatc
ggcatgcggaacctgtgtgaccctcaccgctacaacatcctggaggacgtggctgtctgc
atggacctggacacccggacaacctcgtccctgtggaaagacaaagcagccgtggaaatc
aacgtggctgtgctgcacagttaccagctgtccaaagtgaccatcgtggaccaccatgct
gccacatcttccttcatgaagcacctggagaatgagcagaaggcgagggggggctgccct
gccgactgggcctggatcgtgccccccatctcaggcagcctcacccctgtcttccatcag
gaaatggtcaactatttcctgtcccctgccttccgttaccagccagacccctggaagggg
agcgcagccaaaggcactggcattaccaggaagaagacctttaaggaagtggccaatgcg
gtgaagatctctgcctcactcatgggcacagtgatggccaagcgcgtgaaggcgaccatc
ctgtacggttctgagactggccgggcccagggctacgcgcagcagctggggaggctcttc
cggaaggcttttgacccccgggtcctgtgcatggatgagtatgacgtggtgtcccttgaa
cacgagacgctggtgttggtggtgaccagcacatttgggaatggggatcccccagagaat
ggagagagcttcgcagcggccctgatggagatgtccggcccctacaacagctccccccgg
cctgagcagcacaagagttacaaaatccgcttcaacagcatttcgtgctcagacccgctg
gtgtcctcctggcggcggaagaggaaggagtccagcaacacggacagcgcgggggccctg
gggaccctcaggttctgtgtgttcgggctgggctcccgggcatacccccacttctgtgcc
tttgcccgtgcggtggacacgcggctggaagagctgggcggggagcggctcctacccatg
ggccagggtgatgagctgtgtggccaggaggaggccttccgcggctgggccaaggccgcc
ttccaggcctcctgtgagaccttctgcgtgggagaggatgccaaggctgccacccgggac
atcttcagccccaaacggagctggaagcgccagaggtaccggctgagtgcgcaggccgag
ggcctccagctgctgccaggcctgatgcacgtgcacaggaggaagatgttccaggccacc
gtcctctcagtggaaaaccttcaaagcagcaagtccacccgggccacgatcctggtgcgc
ctggacactggaggccaggcctggctccagtatcagccaggggaccacataggcgtctgc
ccgcccaaccggcccggccttgtggaggcgctgctgagccgcgtggaggacccaccacca
cccggcgagccagtggcggtggagcagctggagaagggcagccctggtggccctcccccc
ggctgggtgcgggacccccggctgcccccctgcacgctgcgccaggccctcaccttcttc
ctggacatcacttccccgcccagccctcagctccttcgactgctcagcaccctggctgaa
gagcccggcgaacaacaggagctcgagaccctcagccaggaccccctgcactatgaggag
tggaagtggttccgttgccccacgctactggaggtgctggagcagttcccatcggtggcg
ctgcccgccccgctgcttctcacccagctgcccctgctccagccccggtactactcagtc
agctcagcgcccagcgcccacctgggggagatccacctcacagtggccgtgctggcatac
aggacccaggatgggctgggtcccctgcactacggagtctgctccacgtggctgagccag
ctcaaggccggggaccctgtaccctgcttcatccgaggggctccctccttccggctgcca
cctgaccccagcttgccatgcatcctggtgggcccgggcaccggcatcgcccccttccgg
gggttttggcaagagcggctgcacgacattgagagcaaagggttgcagcccgcccccatg
actttggtgtttggctgccggtgctcccagcttgaccacctctaccgcgacgaggtgcag
gatgcccaacagcgcggggtgtttggccgagtcctcactgccttctcccgggaacccgac
agccctaagacctacgtgcaggacatccttcggacagagctggctgctgaggtgcaccgc
gtgctgtgcctggaaggaggacacatgtttgtctgcggcgatgtcaccatggcaaccagc
gtcctgcagacggtgcagcgcatcctggcgacagagggcgacatggagctggaggaggcc
ggcgacgtcattggcgtgctgcgggatcagcaacgctatcatgaggacattttcgggctc
acgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttttccttgcaggag
cggcatctgcggggcgcagtgccctgggctttcgacccgcccggctcagacaccccggct
ccctga

DBGET integrated database retrieval system