KEGG   Desmodus rotundus (common vampire bat): 112308317
Entry
112308317         CDS       T05907                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04340  Hedgehog signaling pathway
dro04360  Axon guidance
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05217  Basal cell carcinoma
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    112308317 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    112308317 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112308317 (SHH)
   05205 Proteoglycans in cancer
    112308317 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    112308317 (SHH)
   05217 Basal cell carcinoma
    112308317 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112308317 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dro00536]
    112308317 (SHH)
Peptidases and inhibitors [BR:dro01002]
 Cysteine peptidases
  Family C46: hedgehog family
   112308317 (SHH)
Glycosaminoglycan binding proteins [BR:dro00536]
 Heparan sulfate / Heparin
  Morphogens
   112308317 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 112308317
NCBI-ProteinID: XP_024420280
LinkDB
Position
Unknown
AA seq 282 aa
MLLVARCLLVALVSSLLMCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPREQGLQKQKKKEKKKKEEKKIG
NT seq 849 nt   +upstreamnt  +downstreamnt
atgctgctggtggcgagatgtctgctggttgcgctggtctcctcgctgctgatgtgctcg
gggctggcgtgcggacccggccgggggtttgggaagaggcggcaccccaaaaagctgacc
cctttagcctacaagcagttcatccccaacgtggccgagaagaccctgggggccagtgga
agatacgaagggaagatctcacggaactcggagcggtttaaggaactcacccccaattac
aaccccgacataatatttaaggatgaggagaacacaggagcggaccggctgatgactcag
agatgcaaagacaagttaaatgccctggccatctctgtgatgaaccagtggcccggcgtg
aagctgcgggtgaccgagggctgggacgaggacggccaccactcggaggagtcgctgcac
tatgagggccgcgccgtggacatcaccacgtcggaccgcgaccgcagcaagtatggcatg
ctggcgcgcctggcggtggaggccggcttcgactgggtgtactacgagtccaaagcacac
atccactgctccgtgaaagcagagaactcagtggcggccaagtcgggcggctgcttcccg
ggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggacctgcgcccc
ggggaccgcgtgctggcggccgacgaccagggccggctgctctacagcgatttcctcact
ttcctggaccgcgacgacggcgccaagaaggttttctacgtgatcgagacgcgcgagccc
cgcgagcaaggccttcaaaaacagaagaagaaggagaagaagaagaaggaggagaagaag
ataggttaa

DBGET integrated database retrieval system