KEGG   Desmodus rotundus (common vampire bat): 112308600
Entry
112308600         CDS       T05907                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00220  Arginine biosynthesis
dro00330  Arginine and proline metabolism
dro01100  Metabolic pathways
dro04020  Calcium signaling pathway
dro04066  HIF-1 signaling pathway
dro04146  Peroxisome
dro04371  Apelin signaling pathway
dro04926  Relaxin signaling pathway
dro05010  Alzheimer disease
dro05014  Amyotrophic lateral sclerosis
dro05022  Pathways of neurodegeneration - multiple diseases
dro05133  Pertussis
dro05140  Leishmaniasis
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05146  Amoebiasis
dro05152  Tuberculosis
dro05200  Pathways in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    112308600 (NOS2)
   00330 Arginine and proline metabolism
    112308600 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112308600 (NOS2)
   04066 HIF-1 signaling pathway
    112308600 (NOS2)
   04020 Calcium signaling pathway
    112308600 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112308600 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112308600 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112308600 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112308600 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112308600 (NOS2)
   05014 Amyotrophic lateral sclerosis
    112308600 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    112308600 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    112308600 (NOS2)
   05152 Tuberculosis
    112308600 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112308600 (NOS2)
   05145 Toxoplasmosis
    112308600 (NOS2)
   05140 Leishmaniasis
    112308600 (NOS2)
   05142 Chagas disease
    112308600 (NOS2)
Enzymes [BR:dro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     112308600 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 112308600
NCBI-ProteinID: XP_024420667
LinkDB
Position
Unknown
AA seq 1153 aa
MAYLWKFLFKAKSHLAKEADINNNVGKTVRAPYSAVTQDDPKGHSLGKPQNESLQPFAGT
VKKSPESLVKLNAPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDLACKSKYCLGAIMNSK
SLTRGPRDKPTSPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTG
DELIYATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNIRSA
ITVFPQRSDGKHDFRVWNSQLIRYAGYQMPDGTIRGDPACVEFTQLCIDLGWKPKYGRFD
VVPLVLQADGCDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVSNMLLEVGGLE
FPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVIEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEMLNY
VLSPFYYYQVEAWKTHVWQDEKRRPQRRGIRFQVLVKAVLFASMLMRKTMASRVRATILF
ATETGKSETLAQDLGALFSCAFNPKVLCMDEYRLSHLEEEQLLLVVTSTFGNGGAPGNGE
KLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDVDQKLSHLGASQLTPTGEGDELS
GQEEAFRSWAVQTFKAACETFDVRGKDHIQIPKLYTTSVTWDPRHYRLVPDSQPLDLNKA
LSSVHAKDVFTLKLKSRQNLQSPKSSRTTLLVELSCSGSQGLSYLPGEHLGVFPSNQPAL
VQGILERVVDGTAPHQPMCLETLSETGSYWVRDKRLPPCSLSQALTYFLDITTPPTQLLL
RKLAQLATEEEDRQRLETLCQPSEYNKWKFTNSPTFLEVLGEFPSLRVSASFLLSQLPVL
KPRYYSISSSRDRTPMEVHLTVAVLTYRTQDGQGPLHHGVCSTWLSSLKPEDPVPCFIRS
ASGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLYDVEHKGIQGGRMTLVFGCRRPDEDH
LYREEMLEMAQKRVLHEVHTAYSRLPGQPKGYVQDILQQQLADQVLHVLHKEQGHLYVCG
DVRMARDVTHTLKQLMAAKLSLSEEEVEDYFFQLKDQKRYHEDIFGAVFPYKVKEDGAAG
KPNDPRAPTAHGS
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggcttatctctggaagtttctgttcaaagccaaatcacacttggcgaaggaagcagac
atcaacaataatgtggggaaaaccgtccgggctccctacagtgcagtgacccaggatgac
cccaagggtcacagccttggcaagccccagaatgagtccctccagcccttcgcggggaca
gtgaagaagtctccagagtccctggtcaagctgaatgcgcccccatcggcctgcccaagg
cacgtgaggatcaaaaactggggcagtgggatgaccttccaagacacacttcaccacaag
gccaaaggggatctcgcttgcaagtccaagtattgcttgggagccatcatgaactccaaa
agtttgaccagaggacccagggacaagcctacctccccagacgagcttctacctcaagct
atcgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagaggaacatctg
gccagggtggaagccgtaacaaaggagatagaaacaacaggaacctaccagctgacggga
gatgagctcatctacgccaccaagcaggcctggcgcaatgccccgcgctgcatcgggagg
atccagtggtccaacctacaggtctttgacgcccggagctgctctaccgcccaggaaatg
ttcgagcacatctgcagacacctgcgatatgccaccaacaatggcaacatcaggtcggcc
atcactgtgttcccccaacggagcgatgggaagcatgacttccgcgtctggaactctcag
ctcatccggtatgccggctaccagatgcccgatggcaccatcagaggggaccctgcctgc
gtggagttcacccagctgtgcattgacctgggctggaaacccaagtacggccgcttcgac
gtggtgcctctggtcctgcaggccgatggctgcgaccctgagctcttcgaaatcccgcct
gaccttgtgcttgaggtgcctatggaacatcccaagtacgagtggttccgggagctggag
ctgaagtggtacgccctgcctgcggtgtccaacatgctgctcgaggtgggcggcctcgag
ttcccggggtgccccttcaatggctggtacatgggcacagagatcggggtccgggacttc
tgtgatgtccagcgctacaacatcctggaggaagtgggcagaaggatgggcctggaaacg
cacaagttggcctcactctggaaagaccaggctgtcattgagatcaatgtcgccgtgctc
cacagtttccagaagcagaacgtgaccatcatggaccaccactcggccgctgagtccttc
atgaagtacatgcagaatgagtaccggtcccgagggggctgccctgccgactggatttgg
ctggtccccccgatttctggaagcatcacccccgtgttccaccaggagatgttaaactac
gttctgtcccctttctactactaccaggtggaggcctggaaaacccatgtctggcaggac
gagaagcggagaccccagagaagagggattcggttccaagtcttggttaaagccgtgctc
ttcgcctctatgctgatgcgcaagaccatggcatcccgagtcagagccacaatcctcttt
gcgacagagacgggaaagtcagaaacgctcgcccaggacctgggcgccttgttcagctgc
gccttcaaccccaaggttctctgcatggacgagtacaggctgagccacctggaggaggag
cagctgctgctggtggtgaccagcacgtttgggaacggaggcgccccaggcaacggagag
aaactgaagaaatccctcttcatgctgaaagagctcaccaacaagttcaggtatgccgtg
ttcggccttggttccagcatgtaccctcagttctgcgcctttgctcatgatgtcgaccag
aagttgtcccacctgggagcgtctcagctcaccccgacaggggaaggggacgagctcagt
gggcaggaagaggccttccgcagctgggccgtgcagacattcaaggcagcctgtgagacc
ttcgacgtccgaggcaaggaccacattcagatccccaagctctacaccaccagtgtgacc
tgggacccgcgccactaccggctcgtgcccgactcacagcctttggacctcaacaaagcc
ctcagcagtgtgcacgccaaggatgtgttcaccctgaagctcaagtcacggcagaacctg
cagagtccgaaatccagccgcaccaccctcctggtggaactctcctgttcgggcagccaa
ggtctcagctacctgccaggggagcacctgggcgttttcccaagcaaccagccggccctg
gtccaaggcattttggagcgagtggtggatggcactgcaccccaccaacccatgtgcttg
gagaccctcagcgagaccggcagctactgggtcagggacaagcggctgcccccctgctcc
ctcagccaggccctcacctacttcctggacatcaccacccccccaacacagctgctgctc
cgaaagctggcccagctggccactgaagaggaggacaggcagaggctggagactctgtgc
cagccctcggagtacaacaagtggaagttcaccaacagtcccacgttcctggaggtgctg
ggggagttcccatccctgcgggtgtctgccagcttcctgctctcacagctccctgttctg
aaaccccggtactactccatcagctcatccagggaccgcacacccatggaggtccacctc
accgtggctgtgctcacctaccgcacccaagatggccagggtcccctgcaccacggtgtc
tgcagcacatggcttagcagcctgaagcccgaagacccagtgccctgtttcatacgaagt
gccagcggcttccagctccccgaggacccctcccacccttgcatcctcattgggcctggc
acaggcattgcccccttccgcagtttctggcagcagcggctttatgacgttgaacataaa
gggatccagggtggccgcatgaccctggtgtttgggtgccggcgcccagatgaggaccac
ctctatcgggaggagatgttggagatggcccagaagagggtgctgcatgaggtgcacaca
gcctactctcgcctgcctggccaacccaagggctacgttcaagacatcctgcagcagcag
ctggctgatcaggtgctccacgtgcttcacaaggagcagggccacctctatgtctgtggg
gacgtgcgcatggcccgggatgtgacccacacacttaagcagctgatggcagccaagcta
agcctgagtgaggaagaagtggaggactatttcttccagcttaaggaccagaagcgctat
catgaagatatctttggtgctgtatttccctacaaggtgaaagaggatggggcagcaggg
aagcctaacgatcccagagctccaacagcccacggaagttaa

DBGET integrated database retrieval system