Desmodus rotundus (common vampire bat): 112308825 Help Entry 112308825         CDS       T05907                                  Gene name TP53 Definition (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro01522   Endocrine resistance dro01524   Platinum drug resistance dro04010   MAPK signaling pathway dro04071   Sphingolipid signaling pathway dro04110   Cell cycle dro04115   p53 signaling pathway dro04137   Mitophagy - animal dro04151   PI3K-Akt signaling pathway dro04210   Apoptosis dro04211   Longevity regulating pathway dro04216   Ferroptosis dro04218   Cellular senescence dro04310   Wnt signaling pathway dro04722   Neurotrophin signaling pathway dro04919   Thyroid hormone signaling pathway dro05012   Parkinson disease dro05014   Amyotrophic lateral sclerosis dro05016   Huntington disease dro05160   Hepatitis C dro05161   Hepatitis B dro05162   Measles dro05163   Human cytomegalovirus infection dro05165   Human papillomavirus infection dro05166   Human T-cell leukemia virus 1 infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05168   Herpes simplex virus 1 infection dro05169   Epstein-Barr virus infection dro05200   Pathways in cancer dro05202   Transcriptional misregulation in cancer dro05203   Viral carcinogenesis dro05205   Proteoglycans in cancer dro05206   MicroRNAs in cancer dro05210   Colorectal cancer dro05212   Pancreatic cancer dro05213   Endometrial cancer dro05214   Glioma dro05215   Prostate cancer dro05216   Thyroid cancer dro05217   Basal cell carcinoma dro05218   Melanoma dro05219   Bladder cancer dro05220   Chronic myeloid leukemia dro05222   Small cell lung cancer dro05223   Non-small cell lung cancer dro05224   Breast cancer dro05225   Hepatocellular carcinoma dro05226   Gastric cancer dro05230   Central carbon metabolism in cancer dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112308825 (TP53)    04310 Wnt signaling pathway     112308825 (TP53)    04071 Sphingolipid signaling pathway     112308825 (TP53)    04151 PI3K-Akt signaling pathway     112308825 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     112308825 (TP53)   09143 Cell growth and death    04110 Cell cycle     112308825 (TP53)    04210 Apoptosis     112308825 (TP53)    04216 Ferroptosis     112308825 (TP53)    04115 p53 signaling pathway     112308825 (TP53)    04218 Cellular senescence     112308825 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     112308825 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     112308825 (TP53)   09149 Aging    04211 Longevity regulating pathway     112308825 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112308825 (TP53)    05202 Transcriptional misregulation in cancer     112308825 (TP53)    05206 MicroRNAs in cancer     112308825 (TP53)    05205 Proteoglycans in cancer     112308825 (TP53)    05203 Viral carcinogenesis     112308825 (TP53)    05230 Central carbon metabolism in cancer     112308825 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     112308825 (TP53)    05212 Pancreatic cancer     112308825 (TP53)    05225 Hepatocellular carcinoma     112308825 (TP53)    05226 Gastric cancer     112308825 (TP53)    05214 Glioma     112308825 (TP53)    05216 Thyroid cancer     112308825 (TP53)    05220 Chronic myeloid leukemia     112308825 (TP53)    05217 Basal cell carcinoma     112308825 (TP53)    05218 Melanoma     112308825 (TP53)    05219 Bladder cancer     112308825 (TP53)    05215 Prostate cancer     112308825 (TP53)    05213 Endometrial cancer     112308825 (TP53)    05224 Breast cancer     112308825 (TP53)    05222 Small cell lung cancer     112308825 (TP53)    05223 Non-small cell lung cancer     112308825 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     112308825 (TP53)    05014 Amyotrophic lateral sclerosis     112308825 (TP53)    05016 Huntington disease     112308825 (TP53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112308825 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112308825 (TP53)    05161 Hepatitis B     112308825 (TP53)    05160 Hepatitis C     112308825 (TP53)    05162 Measles     112308825 (TP53)    05168 Herpes simplex virus 1 infection     112308825 (TP53)    05163 Human cytomegalovirus infection     112308825 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     112308825 (TP53)    05169 Epstein-Barr virus infection     112308825 (TP53)    05165 Human papillomavirus infection     112308825 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112308825 (TP53)    01522 Endocrine resistance     112308825 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:dro03000]     112308825 (TP53)    03036 Chromosome and associated proteins [BR:dro03036]     112308825 (TP53)    03400 DNA repair and recombination proteins [BR:dro03400]     112308825 (TP53) Transcription factors [BR:dro03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     112308825 (TP53) Chromosome and associated proteins [BR:dro03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      112308825 (TP53) DNA repair and recombination proteins [BR:dro03400]  Eukaryotic type   Check point factors    Other check point factors     112308825 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  112308825 NCBI-ProteinID:  XP_024420872 LinkDB All DBs Position Unknown AA seq 388 aa AA seqDB search MEDTQSESMEPPMSQETFSHLWNLLHENNVLTSEVSIAVGDDLLLPPDLVNCLDKDPNEV PSMPATPAPAAAVPAPAASPAPATSWPLSSCVPSQKTYPGSYDFHLGFLNSGTAKSVTCT YSSTLNKLFCQLAKTCPVQLWVSSPPPPGTCVRAMAIYKKSEHMTEVVRRCPHHERCSDY SDGLAPPQHLIRVEGNSRATYLEDKNTFRHSVVVPYETPEVGSDCTTIHYNFMCNSSCMG GMNRRPILTIITLEDSNGNLLGRDSFEVRVCACPGRDRRTEEENFRKKREPCPKQSSGST KRTLPTNTDSSPLPKMPVDGEYFLLKIRGHERFEMFRELNEALELKDAQAVKDPGESKTH CSHPKSKKGQSTPRHKKLMFKREGPDSD NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt atggaggacactcagtcagagtccatggagcccccaatgagtcaggagacattttcacac ttgtggaatctacttcatgaaaacaatgtcctgacttcagaggtatccatagcagtgggt gatgacctgctgctgcccccagacctcgtaaactgtctggacaaagatccaaatgaagtc cccagtatgccagcaactcctgcaccagcagctgctgtcccagcaccagccgcctcccca gcaccagccacctcctggcccttgtcatcctgtgtcccttcccagaagacctaccctggc agctatgatttccatttaggattcctgaattctgggacagccaaatctgtaacctgcacg tactcctctaccctcaacaagctgttttgccagctggcaaagacctgccctgtgcaactg tgggtcagctccccacctccgcccggaacatgtgtccgtgccatggccatttataagaag tccgagcacatgacggaggtcgtgagacgctgcccccaccatgagcgctgctctgactac agcgatggtctggcccctcctcagcatcttatccgggtcgaagggaattcgcgcgccacg tatttggaggacaaaaacacttttcgacatagtgtggtggtgccctacgaaacgcccgag gtgggctctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatgggg ggcatgaaccggcggcccattctcaccatcatcacactggaagactccaatggtaatctg ctgggacgggacagctttgaggtgcgtgtttgcgcctgtcctgggagagaccggcgcaca gaggaagaaaatttccgcaagaagcgggagccttgtcccaagcagtcctctgggagcact aagcgaacactgcccaccaacaccgactcctctcccctgccaaagatgccagtggatgga gaatatttcctccttaagatccgtgggcatgaacgcttcgagatgttccgagaactgaat gaagccttggagttaaaggatgcccaggccgtaaaggacccaggggaaagcaagactcac tgcagccacccgaagtctaaaaaggggcagtctaccccccgccataaaaagctcatgttc aagagagagggacctgattcagattga

DBGET integrated database retrieval system