KEGG   Desmodus rotundus (common vampire bat): 112308825
Entry
112308825         CDS       T05907                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01522  Endocrine resistance
dro01524  Platinum drug resistance
dro04010  MAPK signaling pathway
dro04071  Sphingolipid signaling pathway
dro04110  Cell cycle
dro04115  p53 signaling pathway
dro04137  Mitophagy - animal
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04211  Longevity regulating pathway
dro04216  Ferroptosis
dro04218  Cellular senescence
dro04310  Wnt signaling pathway
dro04722  Neurotrophin signaling pathway
dro04919  Thyroid hormone signaling pathway
dro05012  Parkinson disease
dro05014  Amyotrophic lateral sclerosis
dro05016  Huntington disease
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05203  Viral carcinogenesis
dro05205  Proteoglycans in cancer
dro05206  MicroRNAs in cancer
dro05210  Colorectal cancer
dro05212  Pancreatic cancer
dro05213  Endometrial cancer
dro05214  Glioma
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05218  Melanoma
dro05219  Bladder cancer
dro05220  Chronic myeloid leukemia
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05230  Central carbon metabolism in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112308825 (TP53)
   04310 Wnt signaling pathway
    112308825 (TP53)
   04071 Sphingolipid signaling pathway
    112308825 (TP53)
   04151 PI3K-Akt signaling pathway
    112308825 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112308825 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    112308825 (TP53)
   04210 Apoptosis
    112308825 (TP53)
   04216 Ferroptosis
    112308825 (TP53)
   04115 p53 signaling pathway
    112308825 (TP53)
   04218 Cellular senescence
    112308825 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112308825 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112308825 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    112308825 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112308825 (TP53)
   05202 Transcriptional misregulation in cancer
    112308825 (TP53)
   05206 MicroRNAs in cancer
    112308825 (TP53)
   05205 Proteoglycans in cancer
    112308825 (TP53)
   05203 Viral carcinogenesis
    112308825 (TP53)
   05230 Central carbon metabolism in cancer
    112308825 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112308825 (TP53)
   05212 Pancreatic cancer
    112308825 (TP53)
   05225 Hepatocellular carcinoma
    112308825 (TP53)
   05226 Gastric cancer
    112308825 (TP53)
   05214 Glioma
    112308825 (TP53)
   05216 Thyroid cancer
    112308825 (TP53)
   05220 Chronic myeloid leukemia
    112308825 (TP53)
   05217 Basal cell carcinoma
    112308825 (TP53)
   05218 Melanoma
    112308825 (TP53)
   05219 Bladder cancer
    112308825 (TP53)
   05215 Prostate cancer
    112308825 (TP53)
   05213 Endometrial cancer
    112308825 (TP53)
   05224 Breast cancer
    112308825 (TP53)
   05222 Small cell lung cancer
    112308825 (TP53)
   05223 Non-small cell lung cancer
    112308825 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112308825 (TP53)
   05014 Amyotrophic lateral sclerosis
    112308825 (TP53)
   05016 Huntington disease
    112308825 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112308825 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112308825 (TP53)
   05161 Hepatitis B
    112308825 (TP53)
   05160 Hepatitis C
    112308825 (TP53)
   05162 Measles
    112308825 (TP53)
   05168 Herpes simplex virus 1 infection
    112308825 (TP53)
   05163 Human cytomegalovirus infection
    112308825 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112308825 (TP53)
   05169 Epstein-Barr virus infection
    112308825 (TP53)
   05165 Human papillomavirus infection
    112308825 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112308825 (TP53)
   01522 Endocrine resistance
    112308825 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112308825 (TP53)
   03036 Chromosome and associated proteins [BR:dro03036]
    112308825 (TP53)
   03400 DNA repair and recombination proteins [BR:dro03400]
    112308825 (TP53)
Transcription factors [BR:dro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    112308825 (TP53)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     112308825 (TP53)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112308825 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 112308825
NCBI-ProteinID: XP_024420872
LinkDB
Position
Unknown
AA seq 388 aa
MEDTQSESMEPPMSQETFSHLWNLLHENNVLTSEVSIAVGDDLLLPPDLVNCLDKDPNEV
PSMPATPAPAAAVPAPAASPAPATSWPLSSCVPSQKTYPGSYDFHLGFLNSGTAKSVTCT
YSSTLNKLFCQLAKTCPVQLWVSSPPPPGTCVRAMAIYKKSEHMTEVVRRCPHHERCSDY
SDGLAPPQHLIRVEGNSRATYLEDKNTFRHSVVVPYETPEVGSDCTTIHYNFMCNSSCMG
GMNRRPILTIITLEDSNGNLLGRDSFEVRVCACPGRDRRTEEENFRKKREPCPKQSSGST
KRTLPTNTDSSPLPKMPVDGEYFLLKIRGHERFEMFRELNEALELKDAQAVKDPGESKTH
CSHPKSKKGQSTPRHKKLMFKREGPDSD
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggaggacactcagtcagagtccatggagcccccaatgagtcaggagacattttcacac
ttgtggaatctacttcatgaaaacaatgtcctgacttcagaggtatccatagcagtgggt
gatgacctgctgctgcccccagacctcgtaaactgtctggacaaagatccaaatgaagtc
cccagtatgccagcaactcctgcaccagcagctgctgtcccagcaccagccgcctcccca
gcaccagccacctcctggcccttgtcatcctgtgtcccttcccagaagacctaccctggc
agctatgatttccatttaggattcctgaattctgggacagccaaatctgtaacctgcacg
tactcctctaccctcaacaagctgttttgccagctggcaaagacctgccctgtgcaactg
tgggtcagctccccacctccgcccggaacatgtgtccgtgccatggccatttataagaag
tccgagcacatgacggaggtcgtgagacgctgcccccaccatgagcgctgctctgactac
agcgatggtctggcccctcctcagcatcttatccgggtcgaagggaattcgcgcgccacg
tatttggaggacaaaaacacttttcgacatagtgtggtggtgccctacgaaacgcccgag
gtgggctctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatgggg
ggcatgaaccggcggcccattctcaccatcatcacactggaagactccaatggtaatctg
ctgggacgggacagctttgaggtgcgtgtttgcgcctgtcctgggagagaccggcgcaca
gaggaagaaaatttccgcaagaagcgggagccttgtcccaagcagtcctctgggagcact
aagcgaacactgcccaccaacaccgactcctctcccctgccaaagatgccagtggatgga
gaatatttcctccttaagatccgtgggcatgaacgcttcgagatgttccgagaactgaat
gaagccttggagttaaaggatgcccaggccgtaaaggacccaggggaaagcaagactcac
tgcagccacccgaagtctaaaaaggggcagtctaccccccgccataaaaagctcatgttc
aagagagagggacctgattcagattga

DBGET integrated database retrieval system