KEGG   Desmodus rotundus (common vampire bat): 112309331
Entry
112309331         CDS       T05907                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04010  MAPK signaling pathway
dro04020  Calcium signaling pathway
dro04022  cGMP-PKG signaling pathway
dro04024  cAMP signaling pathway
dro04260  Cardiac muscle contraction
dro04261  Adrenergic signaling in cardiomyocytes
dro04270  Vascular smooth muscle contraction
dro04713  Circadian entrainment
dro04720  Long-term potentiation
dro04723  Retrograde endocannabinoid signaling
dro04724  Glutamatergic synapse
dro04725  Cholinergic synapse
dro04726  Serotonergic synapse
dro04727  GABAergic synapse
dro04728  Dopaminergic synapse
dro04742  Taste transduction
dro04911  Insulin secretion
dro04912  GnRH signaling pathway
dro04921  Oxytocin signaling pathway
dro04924  Renin secretion
dro04925  Aldosterone synthesis and secretion
dro04927  Cortisol synthesis and secretion
dro04929  GnRH secretion
dro04930  Type II diabetes mellitus
dro04934  Cushing syndrome
dro04935  Growth hormone synthesis, secretion and action
dro05010  Alzheimer disease
dro05020  Prion disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05031  Amphetamine addiction
dro05410  Hypertrophic cardiomyopathy
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112309331 (CACNA1C)
   04020 Calcium signaling pathway
    112309331 (CACNA1C)
   04024 cAMP signaling pathway
    112309331 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    112309331 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112309331 (CACNA1C)
   04929 GnRH secretion
    112309331 (CACNA1C)
   04912 GnRH signaling pathway
    112309331 (CACNA1C)
   04921 Oxytocin signaling pathway
    112309331 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    112309331 (CACNA1C)
   04924 Renin secretion
    112309331 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    112309331 (CACNA1C)
   04927 Cortisol synthesis and secretion
    112309331 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112309331 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    112309331 (CACNA1C)
   04270 Vascular smooth muscle contraction
    112309331 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    112309331 (CACNA1C)
   04727 GABAergic synapse
    112309331 (CACNA1C)
   04725 Cholinergic synapse
    112309331 (CACNA1C)
   04728 Dopaminergic synapse
    112309331 (CACNA1C)
   04726 Serotonergic synapse
    112309331 (CACNA1C)
   04720 Long-term potentiation
    112309331 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    112309331 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    112309331 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112309331 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112309331 (CACNA1C)
   05020 Prion disease
    112309331 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    112309331 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    112309331 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112309331 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112309331 (CACNA1C)
   05414 Dilated cardiomyopathy
    112309331 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112309331 (CACNA1C)
   04934 Cushing syndrome
    112309331 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dro04040]
    112309331 (CACNA1C)
Ion channels [BR:dro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112309331 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 112309331
NCBI-ProteinID: XP_024421338
LinkDB
Position
Unknown
AA seq 2168 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLVPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKYPLPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLK
VIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKT
CYNQEGIADAPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPRHGITNFDNFAFAMLTVF
QCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKA
RGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRGAPAGLLDQKKGK
FAWFSHSTETHVSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVMEKPAVEETKEEKIELKSITAD
GESPPTTKINMDNLQPNENEDKSVYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAV
PMPEASAFFIFSPNNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFRNHI
LFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAIN
VVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFK
GKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVS
TFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQ
GEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLN
TICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVV
GSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRC
ATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQ
AGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQS
DGRSAFPQTFTTQRPLHINKTGNSPGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANN
TALGRFPRPTGYPSVVSTVEGHGPPLSPAIRVQEASWKLSSKRCHSRESQIAMVCPEEFS
QEETYEAKVREDTEYCSEPSLASTERLAYQDDENRQLTLPEEDKRDTRQSPKRGFLRSAS
LGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPRPC
ATPPATPGSRGWLPQPIPTLRLEGTESSEKLNSSFPSIHCGSWSGEPMPCGENSSTTRRA
RPVSLTVPSQAGAWGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTI
EEMESAADNILSGGTQQSPNGTLLPFVNCRDRGQDRAGGEEDGPCGPSQECRKSEEELQD
SRAYVSSL
NT seq 6507 nt   +upstreamnt  +downstreamnt
atggttaatgaaaacacgaggatgtacatcccagaggaaaaccaccaaggttccaactat
gggagcccacgcccagctcatgccaacatgaatgccaatgcagcagcagggcttgtcccc
gagcacatccccaccccaggggcagccctgtcctggcaggcagccattgatgcggcccgg
caggccaagctgatgggaagtgctggcaatgccaccatctccacggtcagctccacacag
cggaagcggcagcagtatgggaaacccaagaagcagggcagcaccactgccacacgcccg
cctcgtgccctgctctgcctcactctaaagaaccccatccggagggcatgcatcagcatt
gtcgaatggaaatatcctttaccatttgaaatcattattttactgactatttttgccaat
tgtgtggccttagcgatctatattccctttccagaagatgactccaacgccaccaattcc
aacctggaacgagtggaatatctctttctcatcatttttactgtggaagcatttttaaaa
gtaatagcctatggacttctctttcaccctaatgcttacctccgcaatggttggaattta
ctagattttataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaa
gctgacggggcaaatgctctaggagggaaaggggctggatttgatgtgaaggcgctgagg
gcattccgcgtgctgcgccccttgcggctggtgtctggagtcccgagtctccaggtggtt
ctgaattccatcatcaaggccatggtccccctgctgcatattgccctgctagtgctgttt
gtcatcatcatctatgctatcattggcctggagctcttcatggggaagatgcataagacc
tgctacaaccaggaaggcatagcagatgctccagcagaagacgacccctccccttgtgct
ctggagacaggccacggacggcagtgtcagaacggcaccgtgtgcaagcccgggtgggac
gggcccaggcacggcatcaccaactttgacaacttcgccttcgccatgctgacagtgttc
cagtgcatcaccatggagggctggacagatgtgctgtactgggtcaatgatgccgtagga
agggactggccctggatctattttgttacactaatcatcatagggtcattttttgtactt
aacttggttctcggtgtccttagcggagagttctccaaagagagggagaaggccaaggct
cgaggagatttccagaagctgcgagagaagcagcagctggaagaggacctgaaaggctac
ctggactggatcacacaggcggaagacattgaccccgagaatgaggatgaaggcatggat
gaggaaaagccccgaaacagaggagctccagcaggcttgcttgatcagaagaaagggaag
tttgcttggtttagtcactccacagaaacccatgtgagcatgcccacaagtgagacggag
tctgtcaacactgagaacgtggctggcggtgacatcgaaggagaaaactgtggggccagg
ctggcccaccggatctccaagtcgaagttcagtcgctactggcgtcggtggaatcggttc
tgcagaagaaagtgtcgtgccgcggtcaagtccaatgtcttctactggctcgtgatcttc
ctcgtgttcctcaacacgctcaccattgcctcagaacattacaaccagccccactggctc
acagaagtgcaagacacagccaacaaggccctcctggcccttttcaccgcggagatgctg
ctgaagatgtacagcctgggcctgcaggcctacttcgtgtcgctcttcaaccgctttgac
tgcttcattgtgtgcgggggcatcctggagaccatcctggtggagaccaaggtcatgtct
cccttgggcatctctgtgctcagatgtgttcggcttctgcggatattcaaaatcaccagg
tactggaactccttaagcaacctggtggcatccttgctgaactccgtgcgctccatcgcc
tccctcctgctcctcctcttcctcttcatcatcatcttctccctgctggggatgcagctc
tttggaggaaagttcaactttgatgagatgcagacccgaaggagcacatttgataacttt
ccccagtccctcctcactgtgtttcagatcctgaccggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgtatttac
ttcatcatcctcttcatctgtggaaactatatcctactgaatgtattcttggccattgct
gtggacaacctggctgatgccgagagcctcacatctgcccaaaaagaggaagaagaagag
aaggaaagaaagaagctggccaggactgccagcccagagaagaaacaggaggtgatggag
aagccagcagtggaggagaccaaggaggagaaaattgagctgaaatccatcacagctgat
ggagagtcccctcccaccaccaagatcaacatggacaacctccagcccaatgaaaatgaa
gataaaagtgtctaccccaacccagaaactacaggagaagaggatgaggaggagcctgag
atgcccgtgggcccacgcccacgcccactctctgagctgcacctcaaggaaaaggcagtg
cccatgcctgaagccagtgcatttttcatctttagtcccaacaacaggtttcgcctccaa
tgccaccgtatcgtcaatgactcaatcttcaccaacctgatcctcttcttcattctgctc
agcagcatttccctggctgctgaggaccctgtccagcacacctccttccggaaccatatt
ctgttttattttgatattgtttttactaccattttcaccattgaaattgctctgaagatg
actgcttacggggctttcttgcacaagggctccttctgcaggaactacttcaacatcttg
gacctgctagtggtcagcgtgtccctcatctcctttggcatccagtccagtgcaatcaat
gttgtaaagatcttgcgagttctgcgagtcctcaggcccttgagagctatcaacagagcc
aagggactaaagcacgtggttcagtgcgtgttcgtcgccatccggaccatcgggaacatc
gtgatcgtcaccacgctgcttcagttcatgttcgcctgcattggggtgcagctcttcaag
ggaaagctgtacacctgttcagatagctccaagcagacggaggcagaatgcaagggtaac
tacatcacatacaaggatggggaggttgaccaccccatcatccagccccgcagctgggag
aacagcaagtttgactttgacaatgttctggcagccatgatggctctcttcactgtctcc
acctttgaggggtggccggagctgctgtaccgctccatcgactcccacacagaagacaag
ggccccatctacaactaccgagtagagatctccatcttcttcatcatctacatcatcatc
gtcgctttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccaggagcag
ggagagcaggagtacaagaactgtgagctggacaagaaccagcgacagtgtgtggaatat
gccctcaaagcccggcccctgcggaggtacatacccaagaaccagcaccagtacaaagtg
tggtacgtggtcaactccacctactttgagtacctgatgtttgtcctcatcctgctcaac
accatctgcttggccatgcagcactacggtcagagctgcctgtttaaaattgccatgaac
atcctcaacatgctcttcactggcctcttcactgtggagatgattctgaagctcattgcc
tttaaacccaagcactatttctgtgatgcatggaatacgtttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctct
ccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgcctggtcaagctgctgagccgtggagagggcatccggaccctgctgtggacc
ttcatcaagtccttccaggccctgccctacgtggctctgctgatagtgatgctgttcttc
atctatgctgtgatcggaatgcaggtatttgggaaaattgccctgaatgacaccacagag
atcaaccgcaacaacaactttcagaccttcccccaagctgtgctgcttctcttcaggtgt
gccactggggaggcgtggcaggacatcatgctggcctgcatgccagggaagaagtgtgcc
ccagagtctgagcccagcaacagcacggaaggagagacgccctgtggcagcagcttcgct
gtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctctttgta
gctgtcatcatggacaactttgactacctgacaagggactggtccatccttggtccccac
catctggacgaatttaaaagaatctgggcagagtatgacccagaagccaagggtcgtatc
aaacacctggatgtggtgaccctgcttcggcggattcagcccccactgggttttgggaag
ctgtgccctcaccgtgtggcttgcaaacgtctggtctccatgaacatgcctctgaacagt
gatgggacggtcatgttcaatgccaccctgtttgccctggtccggacagctctgagaatc
aaaacagaagggaacctggaacaagccaatgaggagttgcgggccatcatcaagaagatc
tggaagcggaccagcatgaagctgctggaccaagtggtgcctcccgcaggagatgatgaa
gtcacggttggcaagttttatgctactttcttgatccaagagtacttccggaaattcaag
aagcgcaaagagcaaggcctcgtgggcaagccctcccagaggaacgccttgtcgctgcag
gctggcttgcgcacgctgcacgacattggccctgagatccgcagggccatctcgggagac
ctgacggctgaggaggagctggacaaggccatgaaggaggctgtgtctgctgcctctgag
gatgacatcttcaggagagccggaggcctgtttggtaaccatgtcagctactaccaaagc
gatggccggagcgccttcccccagaccttcaccacccagcgcccgctgcatatcaacaag
acgggtaacagtcctggcgacaccgaatcaccgtcccacgaaaagctggtggactccact
ttcacccccagcagctactcctctactggctccaatgccaacatcaacaatgccaacaac
acagccctgggccgctttccccgccccaccggctaccccagcgtggtcagcactgtggag
ggccatggcccacccctgtctcctgctatccgggtgcaggaggcatcgtggaagctcagc
tccaagaggtgccactcccgggagagccagatagccatggtgtgtccggaggagttctct
caggaggagacctatgaggcaaaggtgcgcgaggacacggagtactgcagtgagcccagc
ctggcctccacggagaggctcgcctatcaggatgacgaaaaccgacaactgacactccca
gaggaggacaagagggacacccggcaatctccaaagaggggttttctccgctctgcctcc
ctaggtcggagggcctccttccacctagaatgtctgaagcgacagaagaatcaaggggga
gacatctctcagaagactgtcctgcccttgcatctggttcatcatcaggcactggcagtg
gcaggcctgagccccctcctccagagaagccattctcccaccacgttccccaggccatgt
gccacgccccctgccacgcccggcagccgaggctggctccctcagcccatccccacactt
cggctggaaggaaccgagtccagcgagaaactcaacagcagcttcccgtccatccactgt
ggctcctggtctggggagcccatgccctgtggggagaacagcagcaccacgcggagagcc
cggcctgtgtccctcactgtgcccagccaggccggggcctggggcaggcagttccatggc
agtgccagcagtctggtggaagcggtcttgatttcggaaggactggggcagtttgcccaa
gatcccaagtttatcgaggtcacgacccaggagctggccgacgcctgcgacatgaccata
gaggagatggagagcgctgctgacaacatcctcagtgggggcacccagcagagccccaac
ggcaccctattaccttttgttaactgcagggaccgggggcaggacagagcagggggcgaa
gaggacgggccctgtgggcccagccaggagtgtcggaagagtgaggaggagctgcaggac
agcagagcctacgtcagcagcctgtag

DBGET integrated database retrieval system