KEGG   Desmodus rotundus (common vampire bat): 112309401
Entry
112309401         CDS       T05907                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1 isoform X1
  KO
K16366  endothelin-1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04024  cAMP signaling pathway
dro04066  HIF-1 signaling pathway
dro04080  Neuroactive ligand-receptor interaction
dro04270  Vascular smooth muscle contraction
dro04668  TNF signaling pathway
dro04916  Melanogenesis
dro04924  Renin secretion
dro04926  Relaxin signaling pathway
dro04933  AGE-RAGE signaling pathway in diabetic complications
dro05200  Pathways in cancer
dro05410  Hypertrophic cardiomyopathy
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112309401 (EDN1)
   04066 HIF-1 signaling pathway
    112309401 (EDN1)
   04024 cAMP signaling pathway
    112309401 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112309401 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112309401 (EDN1)
   04916 Melanogenesis
    112309401 (EDN1)
   04924 Renin secretion
    112309401 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112309401 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309401 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112309401 (EDN1)
   05410 Hypertrophic cardiomyopathy
    112309401 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112309401 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 112309401
NCBI-ProteinID: XP_024421388
LinkDB
Position
Unknown
AA seq 199 aa
MDYFPVILSLLFVAFQGAPETAVLGAELSTGVDRGGEKPSPSAARRSKRCSCSSLMDKEC
VYFCHLDIIWVNTPGHIVPYGLGSPSRSRRSLKDSFPTEATDQSSRCQCASQKDKKCWNF
CQAGKALRDQDTMEKDWNNHKKEKDCSKLGKKCIHQQLVEGRKIRRLETISNSIKTSYRI
AKLKAKLYREKKVTHNRTH
NT seq 600 nt   +upstreamnt  +downstreamnt
atggattattttcccgtgattttgtctctgctgtttgtggctttccaaggagctccagag
acagccgtcttgggtgctgagctcagcacaggggtggacagaggaggagagaagccctct
cccagtgcagcccgccgctccaaacgctgctcctgctcttccttgatggataaagaatgt
gtctacttctgccacctcgacatcatctgggtcaacactcctgggcacattgttccatat
ggacttggaagcccttcgaggtccaggagatccttaaaggattcatttcctacagaagcc
acagaccagagcagcagatgccaatgtgctagccaaaaagacaagaagtgctggaatttt
tgccaagcaggaaaagcactcagggaccaagacactatggagaaagactggaataatcac
aagaaagaaaaagactgttccaagctgggaaagaaatgcattcatcagcagctggtggaa
ggaaggaaaataagaaggttggagaccatcagcaacagcatcaaaacatcttaccgcatt
gcaaagctgaaagccaagctctacagagagaagaaagtgacccacaaccggacgcactga

DBGET integrated database retrieval system