KEGG   Desmodus rotundus (common vampire bat): 112309496
Entry
112309496         CDS       T05907                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04015  Rap1 signaling pathway
dro04310  Wnt signaling pathway
dro04390  Hippo signaling pathway
dro04510  Focal adhesion
dro04520  Adherens junction
dro04550  Signaling pathways regulating pluripotency of stem cells
dro04670  Leukocyte transendothelial migration
dro04916  Melanogenesis
dro04919  Thyroid hormone signaling pathway
dro04934  Cushing syndrome
dro05010  Alzheimer disease
dro05022  Pathways of neurodegeneration - multiple diseases
dro05100  Bacterial invasion of epithelial cells
dro05132  Salmonella infection
dro05160  Hepatitis C
dro05163  Human cytomegalovirus infection
dro05165  Human papillomavirus infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05200  Pathways in cancer
dro05205  Proteoglycans in cancer
dro05210  Colorectal cancer
dro05213  Endometrial cancer
dro05215  Prostate cancer
dro05216  Thyroid cancer
dro05217  Basal cell carcinoma
dro05224  Breast cancer
dro05225  Hepatocellular carcinoma
dro05226  Gastric cancer
dro05412  Arrhythmogenic right ventricular cardiomyopathy
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112309496 (CTNNB1)
   04310 Wnt signaling pathway
    112309496 (CTNNB1)
   04390 Hippo signaling pathway
    112309496 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112309496 (CTNNB1)
   04520 Adherens junction
    112309496 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112309496 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    112309496 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112309496 (CTNNB1)
   04916 Melanogenesis
    112309496 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309496 (CTNNB1)
   05205 Proteoglycans in cancer
    112309496 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112309496 (CTNNB1)
   05225 Hepatocellular carcinoma
    112309496 (CTNNB1)
   05226 Gastric cancer
    112309496 (CTNNB1)
   05216 Thyroid cancer
    112309496 (CTNNB1)
   05217 Basal cell carcinoma
    112309496 (CTNNB1)
   05215 Prostate cancer
    112309496 (CTNNB1)
   05213 Endometrial cancer
    112309496 (CTNNB1)
   05224 Breast cancer
    112309496 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112309496 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    112309496 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112309496 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112309496 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112309496 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112309496 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    112309496 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112309496 (CTNNB1)
   05163 Human cytomegalovirus infection
    112309496 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112309496 (CTNNB1)
   05165 Human papillomavirus infection
    112309496 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 112309496
NCBI-ProteinID: XP_024421429
LinkDB
Position
Unknown
AA seq 783 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QQGLYDWDHQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
PTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQL
SKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIP
ALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITT
DCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIV
EAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVT
CAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEA
EMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQ
LLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPL
FVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAV
LFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRS
FHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFD
TDL
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagctggacatggccatggagccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgctact
accacagccccttctctgagtggaaaaggcaatcctgaggaagaagatgtggataccacc
caacaaggcctgtacgactgggaccaccaggggttttctcagtccttcactcaagaacaa
gtagctgatattgatggacagtacgccatgacccgagctcaaagagtacgtgctgctatg
ttccccgagacattagacgagggcatgcagatcccatctacccagttcgatgccgctcac
cccaccaatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaat
ttgattaactatcaagatgatgcagagcttgccacacgtgcgatcccggaactgacgaaa
ctactaaatgatgaggaccaggtggtggttaacaaggctgcagttatggtccatcagctt
tctaaaaaggaagcttccagacacgccatcatgcgctctcctcagatggtgtctgctatt
gtgcgtaccatgcagaacacaaatgatgtggagacagctcgctgtactgctgggaccttg
cacaatctttcccatcatcgtgagggcttgctggccatctttaagtctgggggcattcct
gccctggtgaagatgcttggttcaccggtggattctgtgttgttttatgccatcacaact
ctccacaaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggcggg
ctgcagaaaatggttgccttgctcaacaaaacaaatgttaaattcttggcgattacaaca
gactgccttcagattttagcttacggcaatcaagagagcaagctgatcattctggctagt
ggtggacctcaagctttagtaaatataatgaggacctacacttacgagaagctgctgtgg
accacaagcagagtactgaaggtgctgtctgtctgctccagcaacaaaccggctattgta
gaagctggcgggatgcaagctttaggacttcacctgacagacccaagtcaacgtcttgtt
cagaactgtctttggactcttaggaatctttcagatgctgcaactaaacaggaaggaatg
gaaggtcttcttgggacccttgttcagctgttgggctcagatgatataaatgtggtcacc
tgtgcagctggaattctttctaatctcacctgtaataattacaagaacaagatgatggtg
tgccaagtgggtggtatagaggctcttgtacgtactgtccttcgtgctggtgacagggag
gacatcactgagcctgccatctgtgcccttcgtcatctgaccagccgacaccaggaagca
gagatggcccagaatgctgttcgccttcactatggactgccagttgtggttaaactccta
cacccaccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgcc
ctttgtccagcaaatcatgcacctttgcgtgagcagggtgccattccacgtctagttcag
ttgttggttcgtgcacatcaggatacccagcgtcgtacatctatgggtggcacacagcag
cagtttgtggagggggtccgcatggaagaaatagttgaaggctgtactggagcccttcac
atcctagctcgggacgtccacaaccgaatcgtgatcagaggactaaataccattccattg
tttgtgcagctgctttattctcccattgaaaacatccagagagtagctgcaggggtcctc
tgtgaacttgctcaggacaaggaggctgcagaagctatcgaagctgagggggccacagct
cctctgacagaactgcttcactccaggaatgaaggtgtggcaacatacgcagctgctgtt
ctattccgaatgtctgaggacaagccgcaggattataagaaacggctgtcagttgagctg
accagttctctcttcagaacggagccgatggcttggaatgagactgctgatcttggactt
gatattggtgcccagggagaaccacttggatatcgccaggatgatcccagctatcgttct
tttcactccggcgggtatggccaggatgccttgggtatggaccccatgatggagcacgag
atgggtggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcac
gcccaggacctcatggatgggctgcctccaggggacagcaatcagctggcctggtttgat
actgacctgtaa

DBGET integrated database retrieval system