KEGG   Desmodus rotundus (common vampire bat): 112309542
Entry
112309542         CDS       T05907                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04014  Ras signaling pathway
dro04390  Hippo signaling pathway
dro04392  Hippo signaling pathway - multiple species
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05219  Bladder cancer
dro05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112309542 (RASSF1)
   04390 Hippo signaling pathway
    112309542 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    112309542 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309542 (RASSF1)
   05206 MicroRNAs in cancer
    112309542 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    112309542 (RASSF1)
   05223 Non-small cell lung cancer
    112309542 (RASSF1)
SSDB
Motif
Pfam: Nore1-SARAH RA Mst1_SARAH
Other DBs
NCBI-GeneID: 112309542
NCBI-ProteinID: XP_024421493
LinkDB
Position
Unknown
AA seq 285 aa
MSAYRSELTRFGPGAVETDDCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVDEPVE
WETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPT
LQDARRGLGRSTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFAL
FERAERHGQGGLSTSPHLVYLRKLLDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDA
FSLPELHNFLRILQREEEEHLRQIVQKYSYCRQKIQEALHACPLG
NT seq 858 nt   +upstreamnt  +downstreamnt
atgagcgcctacagatcagagttgacacgttttggtccgggggcagtagagacagatgat
tgcaagttcacttgccactaccgttgccgcgcgctcgtctgcctggactgctgcggacct
cgggatctgggctgggaaccggcgctggagcgggacacaaacgtggacgagcctgtggag
tgggagacacctgacctttctcaggctgagattgagcagaagatcaaggagtacaatggc
cagatcaacagcaacctcttcatgagcctgaataaggacggctcctacacaggcttcatc
aaggttcagttgaagttggtgcgccctgtctcagtgccctccagcaagaagccacccacc
ttgcaggacgcccggcggggcctagggcggagcacagctgtgaagcgccgcacctccttc
tacctgcccaaggatgctgtcaagcacctgcatgtgttgtcacgcacgcgggcacgagag
gtcatcgaggccctgctgcgcaagttcttggtggtggatgacccccgcaagtttgcgctc
tttgagcgggctgagcgccatggccaaggtgggctttccacctcaccccaccttgtgtac
ctccggaagctgttggacgacgagcagcctctgcggctgcggctccttgcagggcccagt
gagaaggccctaagctttgtcctgaaggagaatgattccggggaggtgaactgggatgcc
ttcagcttgcctgaactacacaacttcctgcgcatcctgcagcgggaggaagaggaacac
ctccgtcagattgttcagaagtactcctactgccgccagaagatccaggaggccctgcat
gcctgccccctggggtga

DBGET integrated database retrieval system