KEGG   Desmodus rotundus (common vampire bat): 112309941
Entry
112309941         CDS       T05907                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01524  Platinum drug resistance
dro03430  Mismatch repair
dro03460  Fanconi anemia pathway
dro05200  Pathways in cancer
dro05210  Colorectal cancer
dro05213  Endometrial cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    112309941 (MLH1)
   03460 Fanconi anemia pathway
    112309941 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112309941 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112309941 (MLH1)
   05226 Gastric cancer
    112309941 (MLH1)
   05213 Endometrial cancer
    112309941 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112309941 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dro03400]
    112309941 (MLH1)
DNA repair and recombination proteins [BR:dro03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     112309941 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c Hfx_Cass5
Other DBs
NCBI-GeneID: 112309941
NCBI-ProteinID: XP_024421947
LinkDB
Position
Unknown
AA seq 754 aa
MSLAAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQCFEDLANISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSVHNAGVGFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMKGYISNANYSVKKCIFLLFINHRLVESTALRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVESKLLGSNSSRMYFTQTLLPSLAGPSGEVV
KSTTGGTTSPASKSGDKVYAYQMVRTDSREQKLDAFLQPVSKASQPQVTVPEDSTDPSSV
RENDEEMQELPAPADVAAKNQSSEVGTVEETPDVTEKRGTPSSLSNPRKRHREGSDEEMV
EDGSQKEMTAACTPRRRIINLTSVLSLREEINEQGHETLQEMLHNHSFVGCVNPQWALAQ
HQTKLYLLNTTKLSEELFFQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDG
PKEGLAEYIVEFLKKKTEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLAT
EVNWDEEKECFESLSKECAMFYSVRKQYVTEESTLSGQQSGGPSPTPHPWKWTVEHIVYK
AFRSHLLPPKHFTEDGTVLQLANLPDLYKVFERC
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgtcgctcgccgcgggcgtaattcggagactggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgtgaaagagggaggcctgaagctgattcag
atccaagacaacggcacggggatcaggaaagaagacctggatattgtgtgtgagaggttc
actacaagcaaactgcagtgttttgaggatttggctaacatttctacctacggctttcgg
ggtgaggctttggccagcataagccatgtggctcacgttactattacaaccaaaacagct
gatggaaagtgcgcgtacagagcgagttactccgatgggaagctgaaagcgccccctaaa
ccatgcgcaggcaatcaggggacccagatcacggtggaggaccttttttacaacatatca
acaaggaggaaagcgttaaaaaatccaagtgaggagtatgggaaaattttggaggttgtt
ggcagatactcagtacacaacgcaggcgttggcttctcagttaaaaaacaaggtgagaca
gtagctgacgtcagaacgctgcccaatgccacgaccgtggacaatattcgctccatcttt
ggaaacgctgttagccgagaactgatagaagttgggtgtgaggataaaacgctcgccttc
aaaatgaaaggctacatatccaatgcgaactactcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtggagtcgactgccttaagaaaagccatcgaaacggtgtat
gcagcctatctgcccaaaaacacacacccgttcctgtacctcagtttagaaatcagcccc
cagaatgtggatgtgaacgtgcaccccacaaagcacgaggtccacttcttgcacgaggac
agcatcctggagcgggtgcagcagcacgttgagagcaagctcctgggctccaactcctcc
cggatgtacttcacccagactttactcccaagccttgcgggcccctctggggaggtggtt
aaatccacaacaggagggaccacctcacctgcctctaaaagcggtgacaaggtctatgcc
taccagatggtccgcacggattcccgggagcagaagctcgacgcctttctgcagcctgtg
agcaaagccagtcagccccaggtcaccgtcccagaggacagcacggatccttctagtgtc
agggagaacgacgaggaaatgcaggagctcccagctcctgctgacgtggccgccaagaat
cagagctcagaggtgggcacagtggaggagactccagatgtgacagagaagagagggact
ccctccagcctgagcaaccccagaaagagacatcgggaaggctccgatgaggaaatggtg
gaagatgggtcccaaaaggaaatgacggccgcttgcaccccccggaggaggatcattaac
ctcaccagtgttctgagtctgcgggaggagattaacgagcagggacatgagactctgcag
gagatgctgcacaaccactccttcgtgggctgcgtgaatcctcagtgggccttggcacag
catcagaccaagttataccttctcaacaccaccaaactgagcgaagaactgttcttccag
atactcatatatgattttgcgaattttggtgttctgaggttatcggagccagcaccactc
ttcgacctcgccatgctcgctttagacagtcccgagagtggctggacagaggaagacggt
cccaaggaaggccttgccgagtacattgtcgagtttctgaaaaagaagactgagatgctc
gcagactacttctctttggaaatcgacgaggaagggaacctgattggattaccccttctg
atcgacaactacgtgccccctttggagggtctgcccatcttcattcttcgactagccact
gaggtgaactgggacgaagaaaaggagtgttttgagagcctcagtaaagaatgcgccatg
ttttactccgtccggaagcagtatgtaaccgaggagtcgaccctctcaggccagcagagt
ggagggcccagccccactccacacccctggaagtggactgtggagcacatcgtctacaaa
gccttccgctcacacctcctgcctcctaaacatttcacagaagatggaactgtcctgcag
cttgccaacctgcccgatctgtacaaagtctttgagagatgttaa

DBGET integrated database retrieval system